UGT1A7 Antibody

Images

 
Western Blot: UGT1A7 Antibody [NBP1-91335] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/ Immunofluorescence: UGT1A7 Antibody [NBP1-91335] - Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UGT1A7 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human UGT1A7. Peptide sequence VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGT1A7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against UGT1A7 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGT1A7 Antibody

  • GNT1
  • polypeptide A7
  • UDP glucuronosyltransferase 1 family, polypeptide A7
  • UDP-glucuronosyltransferase 1-7
  • UDP-glucuronosyltransferase 1-G
  • UDPGT 1-7
  • UGT1
  • UGT1-07
  • UGT1G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-06724
Species: Hu
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-69412
Species: Hu
Applications: WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
NBP2-20803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007366-B01P
Species: Hu
Applications: WB
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59786
Species: Hu
Applications: WB
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for UGT1A7 Antibody (NBP1-91335) (0)

There are no publications for UGT1A7 Antibody (NBP1-91335).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT1A7 Antibody (NBP1-91335) (0)

There are no reviews for UGT1A7 Antibody (NBP1-91335). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UGT1A7 Antibody (NBP1-91335) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGT1A7 Products

UGT1A7 NBP1-91335

Bioinformatics Tool for UGT1A7 Antibody (NBP1-91335)

Discover related pathways, diseases and genes to UGT1A7 Antibody (NBP1-91335). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT1A7 Antibody (NBP1-91335)

Discover more about diseases related to UGT1A7 Antibody (NBP1-91335).
 

Pathways for UGT1A7 Antibody (NBP1-91335)

View related products by pathway.

PTMs for UGT1A7 Antibody (NBP1-91335)

Learn more about PTMs related to UGT1A7 Antibody (NBP1-91335).

Blogs on UGT1A7

There are no specific blogs for UGT1A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT1A7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT1A7
Uniprot