Glucose 6 phosphate isomerase Antibody

Images

 
Independent Antibodies: Western Blot: Glucose 6 phosphate isomerase Antibody [NBP1-90177] - Analysis NBP1-90177 (A) shows similar pattern to independent antibody NBP2-58524 (B).
Immunocytochemistry/ Immunofluorescence: Glucose 6 phosphate isomerase Antibody [NBP1-90177] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody [NBP1-90177] - Staining of human parathyroid gland shows moderate cytoplasmic positivity in chief cells.
Western Blot: Glucose 6 phosphate isomerase Antibody [NBP1-90177] - Analysis in human cell line A-549 and human cell line SK-MEL-30.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody [NBP1-90177] - Analysis in human parathyroid gland and pancreas tissues. Corresponding GPI RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody [NBP1-90177] - Staining of human pancreas shows low positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glucose 6 phosphate isomerase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQT
Specificity
Specificity of human Glucose 6 phosphate isomerase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
Glucose 6 phosphate isomerase Knockout 293T Cell Lysate
Control Peptide
Glucose 6 phosphate isomerase Protein (NBP1-90177PEP)
Publications
Read Publication using NBP1-90177.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20124221)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glucose 6 phosphate isomerase Antibody

  • AMFGNPI
  • Autocrine motility factor
  • DKFZp686C13233
  • EC 5.3.1.9
  • glucose phosphate isomerase
  • glucose-6-phosphate isomerase
  • hexose monophosphate isomerase
  • hexosephosphate isomerase
  • neuroleukin
  • NLKSA36
  • oxoisomerase
  • PGI
  • PHI
  • Phosphoglucose isomerase
  • phosphohexomutase
  • Phosphohexose isomerase
  • phosphosaccharomutase
  • SA-36
  • Sperm antigen 36
  • sperm antigen-36

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45880
Species: Hu
Applications: WB, IHC, IHC-P, IF
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89559
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85871
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NB500-330
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
NBP2-67503
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-19827
Species: Mu
Applications: WB
NBP1-90177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Glucose 6 phosphate isomerase Antibody (NBP1-90177)(1)

Reviews for Glucose 6 phosphate isomerase Antibody (NBP1-90177) (0)

There are no reviews for Glucose 6 phosphate isomerase Antibody (NBP1-90177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glucose 6 phosphate isomerase Antibody (NBP1-90177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Glucose 6 phosphate isomerase Products

Bioinformatics Tool for Glucose 6 phosphate isomerase Antibody (NBP1-90177)

Discover related pathways, diseases and genes to Glucose 6 phosphate isomerase Antibody (NBP1-90177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucose 6 phosphate isomerase Antibody (NBP1-90177)

Discover more about diseases related to Glucose 6 phosphate isomerase Antibody (NBP1-90177).
 

Pathways for Glucose 6 phosphate isomerase Antibody (NBP1-90177)

View related products by pathway.

PTMs for Glucose 6 phosphate isomerase Antibody (NBP1-90177)

Learn more about PTMs related to Glucose 6 phosphate isomerase Antibody (NBP1-90177).
 

Research Areas for Glucose 6 phosphate isomerase Antibody (NBP1-90177)

Find related products by research area.

Blogs on Glucose 6 phosphate isomerase

There are no specific blogs for Glucose 6 phosphate isomerase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucose 6 phosphate isomerase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPI