Glucose 6 phosphate isomerase Antibody

Images

 
Western Blot: Glucose 6 phosphate isomerase Antibody [NBP1-90177] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: Glucose 6 phosphate isomerase Antibody [NBP1-90177] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody [NBP1-90177] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous duct and Leydig cells.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody [NBP1-90177] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glucose 6 phosphate isomerase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glucose 6 phosphate isomerase Protein (NBP1-90177PEP)
Publications
Read Publication using NBP1-90177.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20124221)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glucose 6 phosphate isomerase Antibody

  • AMFGNPI
  • Autocrine motility factor
  • DKFZp686C13233
  • EC 5.3.1.9
  • glucose phosphate isomerase
  • glucose-6-phosphate isomerase
  • hexose monophosphate isomerase
  • hexosephosphate isomerase
  • neuroleukin
  • NLKSA36
  • oxoisomerase
  • PGI
  • PHI
  • Phosphoglucose isomerase
  • phosphohexomutase
  • Phosphohexose isomerase
  • phosphosaccharomutase
  • SA-36
  • Sperm antigen 36
  • sperm antigen-36

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
AF2009
Species: Hu
Applications: WB, IHC
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP1-90177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Glucose 6 phosphate isomerase Antibody (NBP1-90177)(1)

Reviews for Glucose 6 phosphate isomerase Antibody (NBP1-90177) (0)

There are no reviews for Glucose 6 phosphate isomerase Antibody (NBP1-90177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glucose 6 phosphate isomerase Antibody (NBP1-90177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glucose 6 phosphate isomerase Products

Bioinformatics Tool for Glucose 6 phosphate isomerase Antibody (NBP1-90177)

Discover related pathways, diseases and genes to Glucose 6 phosphate isomerase Antibody (NBP1-90177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucose 6 phosphate isomerase Antibody (NBP1-90177)

Discover more about diseases related to Glucose 6 phosphate isomerase Antibody (NBP1-90177).
 

Pathways for Glucose 6 phosphate isomerase Antibody (NBP1-90177)

View related products by pathway.

PTMs for Glucose 6 phosphate isomerase Antibody (NBP1-90177)

Learn more about PTMs related to Glucose 6 phosphate isomerase Antibody (NBP1-90177).
 

Research Areas for Glucose 6 phosphate isomerase Antibody (NBP1-90177)

Find related products by research area.

Blogs on Glucose 6 phosphate isomerase

There are no specific blogs for Glucose 6 phosphate isomerase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucose 6 phosphate isomerase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPI