PIGA Antibody

Images

 
Immunohistochemistry-Paraffin: PIGA Antibody [NBP2-13760] - Staining of human Prostate shows moderate granular cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: PIGA Antibody [NBP2-13760] - Staining of human gallbladder shows granulated cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PIGA Antibody [NBP2-13760] - Staining of human Duodenum shows strong granular cytoplasmic positivity in goblet cells.
Immunohistochemistry-Paraffin: PIGA Antibody [NBP2-13760] - Staining of human Kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PIGA Antibody [NBP2-13760] - Staining of human Skin shows very weak granular cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: FADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQKYPDLNFIIGGEGPKRII
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIGA Protein (NBP2-13760PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIGA Antibody

  • class A GlcNAc-inositol phospholipid assembly protein
  • EC 2.4.1.198
  • GlcNAc-PI synthesis protein
  • GPI anchor biosynthesis
  • GPI3
  • phosphatidylinositol glycan anchor biosynthesis, class A
  • phosphatidylinositol glycan, class A (paroxysmal nocturnal hemoglobinuria)
  • phosphatidylinositol N-acetylglucosaminyltransferase subunit A
  • Phosphatidylinositol-glycan biosynthesis class A protein
  • phosphatidylinositol-glycan biosynthesis, class A protein
  • PIG-A

Background

PIGA, also known as Phosphatidylinositol N-acetylglucosaminyltransferase subunit A, has three isoforms that are produced by alternative splicing. Isoform 1, the canonical sequence, is 484 amino acids long and 54 kDa. Isoform 2 and 3 are both shorter isoforms, at 315 and 250 amino acids, respectively. PIGA is a critical player in the synthesis of N-acetylglucosaminyl-phosphatidylinositol, which is the first intermediate in the biosynthesis of GPI anchors. Current research on PIGA is being conducted in relation to several diseases and disorders including Paroxysmal nocturnal hemoglobinuria, which may be caused by mutations in the PIGA gene. Other diseases and disorders related to PIGA include multiple congenital anomalies-hypotonia-seizures syndrome type 2, anemia, Burkitt's lymphoma, hepatic vein thrombosis and Myelodysplastic syndrome. PIGA has been shown to have interactions with DPM2, PIGQ, PIGH, PYURF and PIGP in pathways such as GPI anchor biosynthesis and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-86283
Species: Hu
Applications: IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
H00009091-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-83342
Species: Hu
Applications: IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85856
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DY2037
Species: Hu
Applications: ELISA
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF482
Species: Mu
Applications: IHC, WB
AF3327
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
NBP2-13760
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PIGA Antibody (NBP2-13760) (0)

There are no publications for PIGA Antibody (NBP2-13760).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGA Antibody (NBP2-13760) (0)

There are no reviews for PIGA Antibody (NBP2-13760). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIGA Antibody (NBP2-13760) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGA Products

Array NBP2-13760

Bioinformatics Tool for PIGA Antibody (NBP2-13760)

Discover related pathways, diseases and genes to PIGA Antibody (NBP2-13760). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGA Antibody (NBP2-13760)

Discover more about diseases related to PIGA Antibody (NBP2-13760).
 

Pathways for PIGA Antibody (NBP2-13760)

View related products by pathway.

PTMs for PIGA Antibody (NBP2-13760)

Learn more about PTMs related to PIGA Antibody (NBP2-13760).
 

Research Areas for PIGA Antibody (NBP2-13760)

Find related products by research area.

Blogs on PIGA

There are no specific blogs for PIGA, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGA