Recombinant Human Glucose 1-dehydrogenase Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Glucose 1-dehydrogenase Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 401-500 of Human H6PD partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HIGHGDLGSPAVLVSRNLFRPSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVRERDAHSVLLSHIFHGRKNFFITTENLLASWNFWTPLLESLAHKAPRL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
H6PD

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Glucose 1-dehydrogenase Protein

  • 6-phosphogluconolactonase
  • DKFZp686A01246
  • EC 1.1.1.49
  • EC 2.7.4.3
  • EC 3.1.1.31
  • G6PD, H form
  • G6PDH
  • GDH/6PGL endoplasmic bifunctional protein
  • GDHglucose 1- dehydrogenase
  • glucose dehydrogenase
  • glucose dehyrogenase
  • glucose-6-phosphate dehydrogenase, salivary
  • hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
  • MGC87643

Background

H6PD - hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54755
Species: Hu
Applications: WB
NBP2-34980
Species: Hu
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP

Publications for Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01) (0)

There are no publications for Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01) (0)

There are no reviews for Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glucose 1-dehydrogenase Products

Bioinformatics Tool for Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01)

Discover related pathways, diseases and genes to Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01)

Discover more about diseases related to Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01).
 

Pathways for Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01)

View related products by pathway.

PTMs for Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01)

Learn more about PTMs related to Glucose 1-dehydrogenase Partial Recombinant Protein (H00009563-Q01).

Blogs on Glucose 1-dehydrogenase

There are no specific blogs for Glucose 1-dehydrogenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SDHB Antibody
NBP1-87069

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Glucose 1-dehydrogenase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol H6PD