GIN-1 Antibody

Images

 
Immunohistochemistry: GIN-1 Antibody [NBP1-89856] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GIN-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NGDLHLKQIAYYKRTGEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GIN-1 Protein (NBP1-89856PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GIN-1 Antibody

  • GIN-1gypsy integrase 1
  • gypsy retrotransposon integrase 1
  • TGIN1gypsy retrotransposon integrase-like protein 1
  • Ty3/Gypsy integrase 1
  • ZH2C2
  • Zinc finger H2C2 domain-containing protein
  • zinc finger, H2C2 domain containing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87066
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89703
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89856
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for GIN-1 Antibody (NBP1-89856) (0)

There are no publications for GIN-1 Antibody (NBP1-89856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIN-1 Antibody (NBP1-89856) (0)

There are no reviews for GIN-1 Antibody (NBP1-89856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GIN-1 Antibody (NBP1-89856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GIN-1 Products

Bioinformatics Tool for GIN-1 Antibody (NBP1-89856)

Discover related pathways, diseases and genes to GIN-1 Antibody (NBP1-89856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIN-1 Antibody (NBP1-89856)

Discover more about diseases related to GIN-1 Antibody (NBP1-89856).
 

Pathways for GIN-1 Antibody (NBP1-89856)

View related products by pathway.

PTMs for GIN-1 Antibody (NBP1-89856)

Learn more about PTMs related to GIN-1 Antibody (NBP1-89856).

Blogs on GIN-1

There are no specific blogs for GIN-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GIN-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GIN1