C5orf30 Antibody

Images

 
Western Blot: C5orf30 Antibody [NBP2-14416] - Analysis in control (vector only transfected HEK293T lysate) and C5orf30 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: C5orf30 Antibody [NBP2-14416] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C5orf30 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKC
Predicted Species
Mouse (94%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C5ORF30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C5orf30 Protein (NBP2-14416PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C5orf30 Antibody

  • chromosome 5 open reading frame 30
  • FLJ25291
  • hypothetical protein LOC90355

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3428
Species: Hu
Applications: IHC, WB
NBP2-14719
Species: Hu
Applications: IHC, IHC-P, WB
H00006775-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
H00054826-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-14093
Species: Hu
Applications: IHC, IHC-P, WB
H00000640-M02
Species: Hu, Mu, Rt
Applications: ELISA, Flow, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
NBP2-93808
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DGP00
Species: Hu
Applications: ELISA
MAB342
Species: Hu
Applications: AgAct, ICC, WB
7770-GT
Species: Hu
Applications: EnzAct
NBP1-77533
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-87714
Species: Hu
Applications: IHC, IHC-P
NBP2-14416
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for C5orf30 Antibody (NBP2-14416) (0)

There are no publications for C5orf30 Antibody (NBP2-14416).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C5orf30 Antibody (NBP2-14416) (0)

There are no reviews for C5orf30 Antibody (NBP2-14416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C5orf30 Antibody (NBP2-14416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C5orf30 Products

Diseases for C5orf30 Antibody (NBP2-14416)

Discover more about diseases related to C5orf30 Antibody (NBP2-14416).

Blogs on C5orf30

There are no specific blogs for C5orf30, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C5orf30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C5ORF30