C5orf30 Antibody

Images

 
Western Blot: C5orf30 Antibody [NBP2-14416] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: C5orf30 Antibody [NBP2-14416] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & mitochondria.
Immunohistochemistry-Paraffin: C5orf30 Antibody [NBP2-14416] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C5orf30 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSG YQILHMDSNYLVGFTTGEELLKLAQKC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C5ORF30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C5orf30 Protein (NBP2-14416PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C5orf30 Antibody

  • chromosome 5 open reading frame 30
  • FLJ25291
  • hypothetical protein LOC90355

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3428
Species: Hu
Applications: WB, IHC
NBP2-14719
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP1-89856
Species: Hu
Applications: IHC, IHC-P
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00000640-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
NBP1-87714
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for C5orf30 Antibody (NBP2-14416) (0)

There are no publications for C5orf30 Antibody (NBP2-14416).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C5orf30 Antibody (NBP2-14416) (0)

There are no reviews for C5orf30 Antibody (NBP2-14416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C5orf30 Antibody (NBP2-14416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C5orf30 Products

Bioinformatics Tool for C5orf30 Antibody (NBP2-14416)

Discover related pathways, diseases and genes to C5orf30 Antibody (NBP2-14416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C5orf30 Antibody (NBP2-14416)

Discover more about diseases related to C5orf30 Antibody (NBP2-14416).

Blogs on C5orf30

There are no specific blogs for C5orf30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C5orf30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C5ORF30