| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DHRS3 Antibody - BSA Free (NBP1-80846) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DHRS3 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DHRS3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-80846 | Applications | Species |
|---|---|---|
| Wang C, Holtzman DM. The Bidirectional Relationship between the Circadian Clock and Alzheimer's disease Thesis 2022-01-01 [PMID: 31408876] (IHC-P, Mouse) Details: 1:2000 dilution IHC-P |
IHC-P | Mouse |
| Acton L Investigating Mechanisms Responsible for the Pro-Regenerative Effects of Conditioning Electrical Stimulation Thesis 2022-01-01 (IHC-Fr, Mouse) Details: Adult 129S6/SvEvTac (wildtype) mice, IHC-Fr dilution used 1:500 |
IHC-Fr | Mouse |
| Hiyama Y, Yamaoka E, Fukazawa T et al. In Vitro Transfection of Up-Regulated Genes Identified in Favorable-Outcome Neuroblastoma into Cell Lines Cells 2022-10-10 [PMID: 36231133] | ||
| Deisenroth C, Itahana Y, Tollini L et al. p53-Inducible DHRS3 is an endoplasmic reticulum protein associated with lipid droplet accumulation. J Biol Chem 2011-08-01 [PMID: 21659514] |
Secondary Antibodies |
Isotype Controls |
Research Areas for DHRS3 Antibody (NBP1-80846)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.