GHITM Recombinant Protein Antigen

Images

 
There are currently no images for GHITM Protein (NBP1-84269PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GHITM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GHITM.

Source: E.coli

Amino Acid Sequence: DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GHITM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84269.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GHITM Recombinant Protein Antigen

  • Dermal papilla-derived protein 2
  • DERP2MICS1
  • DKFZp566C0746
  • FLJ26584
  • growth hormone inducible transmembrane protein
  • growth hormone-inducible transmembrane protein
  • HSPC282
  • Mitochondrial morphology and cristae structure 1
  • PTD010
  • TMBIM5My021
  • transmembrane BAX inhibitor motif containing 5
  • Transmembrane BAX inhibitor motif-containing protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-26393
Species: Hu
Applications: ICC/IF, WB
H00051053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-20584
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24713
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-24919
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-61745
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
350-NS/CF
Species: Fe, Hu, RM
Applications: BA, BA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DBD00
Species: Hu
Applications: ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DIP100
Species: Hu
Applications: ELISA
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
DFS00
Species: Hu
Applications: ELISA
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-84269PEP
Species: Hu
Applications: AC

Publications for GHITM Protein (NBP1-84269PEP) (0)

There are no publications for GHITM Protein (NBP1-84269PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GHITM Protein (NBP1-84269PEP) (0)

There are no reviews for GHITM Protein (NBP1-84269PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GHITM Protein (NBP1-84269PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GHITM Products

Bioinformatics Tool for GHITM Protein (NBP1-84269PEP)

Discover related pathways, diseases and genes to GHITM Protein (NBP1-84269PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GHITM Protein (NBP1-84269PEP)

Discover more about diseases related to GHITM Protein (NBP1-84269PEP).
 

Pathways for GHITM Protein (NBP1-84269PEP)

View related products by pathway.

PTMs for GHITM Protein (NBP1-84269PEP)

Learn more about PTMs related to GHITM Protein (NBP1-84269PEP).

Blogs on GHITM

There are no specific blogs for GHITM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GHITM Antibody
NBP1-47217

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GHITM Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GHITM