GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553] - Human Brain lysate, concentration 0.2-1 ug/ml.

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human GFRA2. Peptide sequence NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GFRA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

• GDNF family receptor alpha 2
• GDNF family receptor alpha-2
• GDNF R alpha-2
• GDNF receptor alpha-2
• GDNF receptor beta
• GDNFR-alpha-2
• GDNFR-beta
• GDNFRBRET ligand 2
• GFR alpha2
• GFR alpha-2
• GFRA2
• GFRa-2
• GFR-alpha 2
• GFR-alpha-2
• glial cell line derived neurotrophic factor receptor, beta
• Neurturin receptor alpha
• NRTNR-alpha
• NTNRA
• NTNR-alpha
• PI-linked cell-surface accessory protein
• RETL2TGF-beta-related neurotrophic factor receptor 2
• TGF-beta related neurotrophic factor receptor 2
• TRN receptor, GPI-anchored
• TRNR2NRTNR-ALPHA

Background

Members of the glial cell line derived neurotrophic factor (GDNF) family, including GDNF and neurturin (NTN), play key roles in the control of vertebrate neuron survival and differentiation. Physiological responses to NTN require the presence of a novel glycosylphosphadidylinositol linked protein NTNRa, which is a cell surface receptor for NTN. The cDNAs encoding NTNRa from human, rat, chicken, and mouse have been cloned recently. NTNRa was also termed GDNFRb, Ret ligand 2 (RETL2) or TGFb related neurotrophic factor receptor 2 (TrnR2) and nominated as GFRa2 recently. GFRa2 binds NTN and mediates activation of RET receptor tyrosine kinase by both NTN and GDNF. Thus, NTN, GFRa2, and the Ret PTK form a complex to transduce NTN signal and to mediate NTN function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GFRA2
• Uniprot:
  • NP_001486(Human)