GFR alpha-1/GDNF R alpha-1 Antibody (1G4)

Images

 
Immunocytochemistry/ Immunofluorescence: GFR alpha-1/GDNF R alpha-1 Antibody (1G4) [H00002674-M01] - Analysis of monoclonal antibody to GFRA1 on HeLa cell . Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GFR alpha-1/GDNF R alpha-1 Antibody (1G4) Summary

Immunogen
GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS
Specificity
GFRA1 (1G4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GFRA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GFR alpha-1/GDNF R alpha-1 Antibody (1G4)

  • DKFZp313E1012
  • DKFZp686J0156
  • GDNF family receptor alpha 1
  • GDNF family receptor alpha-1
  • GDNF R alpha-1
  • GDNF receptor alpha-1
  • GDNFRAGFR-ALPHA-1
  • GDNFR-alpha-1
  • GDNFRMGC23045
  • GFR alpha1
  • GFR alpha-1
  • GFRA1
  • GFRa-1
  • GFR-alpha-1
  • Glial cell line-derived neurotrophic factor receptor alpha
  • GPI-linked anchor protein
  • PI-linked cell-surface accessory protein
  • RET ligand 1
  • RET1L
  • RETL1FLJ10561
  • TGF-beta related neurotrophic factor receptor 1
  • TGF-beta-related neurotrophic factor receptor 1
  • TRNR1FLJ31546

Background

Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Two alternatively spliced transcipt variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

212-GD/CF
Species: Hu
Applications: Bind, BA
AF482
Species: Mu
Applications: IHC, WB
1297-NE/CF
Species: Hu
Applications: Bind, BA
AF429
Species: Hu, Mu
Applications: Block, ICC, IHC, WB
AF1085
Species: Mu
Applications: IHC, Neut, WB
267-N3/CF
Species: Hu
Applications: BA
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
NBP2-35208
Species: Hu
Applications: BA, Func, PAGE
DBD00
Species: Hu
Applications: ELISA
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-15184
Species: Hu, Rt
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, Simple Western
AF1056
Species: Rt
Applications: IHC, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002674-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01) (0)

There are no publications for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01) (0)

There are no reviews for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GFR alpha-1/GDNF R alpha-1 Products

Bioinformatics Tool for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01)

Discover related pathways, diseases and genes to GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01)

Discover more about diseases related to GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01).
 

Pathways for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01)

View related products by pathway.

PTMs for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01)

Learn more about PTMs related to GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01).
 

Research Areas for GFR alpha-1/GDNF R alpha-1 Antibody (H00002674-M01)

Find related products by research area.

Blogs on GFR alpha-1/GDNF R alpha-1

There are no specific blogs for GFR alpha-1/GDNF R alpha-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GFR alpha-1/GDNF R alpha-1 Antibody (1G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol GFRA1
Entrez
OMIM
Uniprot