GEN1 Antibody

Images

 
Western Blot: GEN1 Antibody [NBP2-30783] - Analysis in human cell line RH-30.
Immunocytochemistry/ Immunofluorescence: GEN1 Antibody [NBP2-30783] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GEN1 Antibody [NBP2-30783] - Staining of human kidney shows membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GEN1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SILSVKESCIANSGSDCTSHLSKDLPGIPLQNESRDSKILKGDQLLQEDYKVNTSVPYSVSNTVVKTCNVRPPNTALDHSRKVDMQTTRKILMKKSVCLDRHSSDEQSAPVFGKAKYTTQRMKHSSQKHNSSHFKESGHNKLSSPKI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GEN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GEN1 Protein (NBP2-30783PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GEN1 Antibody

  • DKFZp781F0986
  • EC 3.1
  • flap endonuclease GEN homolog 1
  • FLJ40869
  • Gen homolog 1, endonuclease (Drosophila)
  • Gen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF4715
Species: Mu
Applications: WB
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBL1-12154
Species: Hu
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GEN1 Antibody (NBP2-30783) (0)

There are no publications for GEN1 Antibody (NBP2-30783).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEN1 Antibody (NBP2-30783) (0)

There are no reviews for GEN1 Antibody (NBP2-30783). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GEN1 Antibody (NBP2-30783) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GEN1 Products

Bioinformatics Tool for GEN1 Antibody (NBP2-30783)

Discover related pathways, diseases and genes to GEN1 Antibody (NBP2-30783). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GEN1 Antibody (NBP2-30783)

Discover more about diseases related to GEN1 Antibody (NBP2-30783).
 

Pathways for GEN1 Antibody (NBP2-30783)

View related products by pathway.

PTMs for GEN1 Antibody (NBP2-30783)

Learn more about PTMs related to GEN1 Antibody (NBP2-30783).

Blogs on GEN1

There are no specific blogs for GEN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GEN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GEN1
Uniprot