Gemin 7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Gemin 7 Antibody [NBP2-58154] - Staining of human cell line MCF7 shows localization to nucleus & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gemin 7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAM
Specificity
Specificity of human Gemin 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GEMIN7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Gemin 7 Recombinant Protein Antigen (NBP2-58154PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Gemin 7 Antibody

  • FLJ13956
  • gem (nuclear organelle) associated protein 7
  • gem-associated protein 7
  • gemin 7
  • gemin-7
  • SIP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC, IHC-P
H00079833-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45831
Species: Hu
Applications: WB, IHC
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52454
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
NBP1-82991
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NB100-61049
Species: Hu, Po, Ba, SyHa
Applications: WB, IP
NBP1-76636
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NB110-40591
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-55266
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45832
Species: Hu
Applications: WB, IHC
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NBP2-94255
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP1-71915
Species: Hu, Mu
Applications: WB, IP, KD

Publications for Gemin 7 Antibody (NBP2-58154) (0)

There are no publications for Gemin 7 Antibody (NBP2-58154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gemin 7 Antibody (NBP2-58154) (0)

There are no reviews for Gemin 7 Antibody (NBP2-58154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Gemin 7 Antibody (NBP2-58154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Gemin 7 Products

Bioinformatics Tool for Gemin 7 Antibody (NBP2-58154)

Discover related pathways, diseases and genes to Gemin 7 Antibody (NBP2-58154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gemin 7 Antibody (NBP2-58154)

Discover more about diseases related to Gemin 7 Antibody (NBP2-58154).
 

Pathways for Gemin 7 Antibody (NBP2-58154)

View related products by pathway.

PTMs for Gemin 7 Antibody (NBP2-58154)

Learn more about PTMs related to Gemin 7 Antibody (NBP2-58154).

Blogs on Gemin 7

There are no specific blogs for Gemin 7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gemin 7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GEMIN7