Gemin 3 Recombinant Protein Antigen

Images

 
There are currently no images for Gemin 3 Protein (NBP1-84058PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Gemin 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX20.

Source: E. coli

Amino Acid Sequence: MAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHGDH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDX20
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84058.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Gemin 3 Recombinant Protein Antigen

  • Component of gems 3
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
  • DEAD box protein 20
  • DEAD box protein DP 103
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103kD
  • DKFZp434H052
  • DP103DEAD-box protein DP103
  • EC 3.6.4.13
  • Gemin-3
  • GEMIN3gemin-3
  • probable ATP-dependent RNA helicase DDX20
  • SMN-interacting protein

Background

The survival of motor neurons (SMN) gene is the disease gene of spinal muscular atrophy (SMA), a common motor neuron degenerative disease. The SMN protein is part of a complex containing several proteins, of which one, SIP1 (SMN interacting protein 1), has been characterized so far. The SMN complex is found in both the cytoplasm and in the nucleus, where it is concentrated in bodies called gems. In the cytoplasm, SMN and SIP1 interact with the Sm core proteins of spliceosomal small nuclear ribonucleoproteins (snRNPs), and they play a critical role in snRNP assembly. In the nucleus, SMN is required for pre-mRNA splicing, likely by serving in the regeneration of snRNPs. A DEAD box putative RNA helicase, named Gemin 3 which is another component of the SMN complex, has been identified. Gemin 3 interacts directly with SMN, as well as with SmB, SmD2 and SmD3. Immunolocalization studies using mAbs to Gemin 3 show that it colocalizes with SMN in gems. Gemin 3 binds SMN via its unique COOH-terminal domain, and SMN mutations found in some SMA patients strongly reduce this interaction. The presence of a DEAD box motif in Gemin 3 suggests that it may provide the catalytic activity that plays a critical role in the function of the SMN complex on RNPs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-83280
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-40591
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-82991
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-62651
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-61049
Species: Ba, SyHa, Hu, Po
Applications: IP, WB
NB100-55266
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-80931
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC,  IHC-P, KD, WB
NB200-351
Species: Ha, Hu, Mu
Applications: IHC,  IHC-P, IP, WB
H00079833-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-20438
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84058PEP
Species: Hu
Applications: AC

Publications for Gemin 3 Protein (NBP1-84058PEP) (0)

There are no publications for Gemin 3 Protein (NBP1-84058PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gemin 3 Protein (NBP1-84058PEP) (0)

There are no reviews for Gemin 3 Protein (NBP1-84058PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Gemin 3 Protein (NBP1-84058PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gemin 3 Products

Research Areas for Gemin 3 Protein (NBP1-84058PEP)

Find related products by research area.

Blogs on Gemin 3

There are no specific blogs for Gemin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Gemin 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX20