GDF-9 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GDF-9. Source: E. coli
Amino Acid Sequence: YNINNSVSFSSAVKCVCNLMIKEPKSSSRTLGRAPYSFTFNSQFEFGKKHKWIQIDVTSLLQPLVASNKRSIHMSINFTCMKDQLEHP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GDF9 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49589. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GDF-9 Recombinant Protein Antigen
Background
GDF9, also known as Growth/differentiation factor 9, is a 454 amino acid that is 51 kDa, is a multifunctional protein required for ovarian folliculogenesis; directly affects oocyte growth and function; stimulates granulosa cell proliferation; promotes primordial follicle development and cell transition from G0/G1 to S; regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells; increases the expression of inhibin B and suppresses FST and FSTL3 production in granulosa-lutein cells. Disease research is currently being studied with relation to GDF9 and polycystic ovary syndrome, premature ovarian failure, blepharophimosis, galactosemia, infertility, gonadal dysgenesis, twinning, prostate cancer, Huntington's disease, endometriosis, prostatitis, breast cancer, and hepatitis B. Interactions with GDF9 protein have been shown to involve SMN1, SMN2, APLP1, GADD45G, TK1, PRKRA and around 50 other interacting proteins in nuclear receptor activation by vitamin-A, paxillin interactions, telomerase components in cell signaling, mitochondrial apoptosis, molecular mechanisms of cancer, antioxidant action of vitamin-C, eIF2 pathway, intracellular calcium signaling, JNK pathway, apoptotic pathways in synovial fibroblasts plus 44 more other pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Publications for GDF-9 Recombinant Protein Antigen (NBP2-49589PEP) (0)
There are no publications for GDF-9 Recombinant Protein Antigen (NBP2-49589PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GDF-9 Recombinant Protein Antigen (NBP2-49589PEP) (0)
There are no reviews for GDF-9 Recombinant Protein Antigen (NBP2-49589PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GDF-9 Recombinant Protein Antigen (NBP2-49589PEP) (0)
Additional GDF-9 Products
Research Areas for GDF-9 Recombinant Protein Antigen (NBP2-49589PEP)
Find related products by research area.
|
Blogs on GDF-9