GDF-9 Antibody (53/1) - BSA Free

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 53/1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

GDF-9 Antibody (53/1) - BSA Free Summary

• Description: Novus Biologicals Mouse GDF-9 Antibody (53/1) - BSA Free (NBP2-61934) is a monoclonal antibody validated for use in IHC, WB and ELISA. Anti-GDF-9 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: GDF9
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Western Blot
• Application Notes: Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF-9 biological activity. Positive control(s): Ovary
• Theoretical MW: 17.5 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS
• Preservative: 0.02% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for GDF-9 Antibody (53/1) - BSA Free

• GDF9
• GDF-9
• growth differentiation factor 9
• growth/differentiation factor 9

Background

GDF-9 is plays a vital role in ovarian folliculogenesis, follicle development and fertility. Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF-9 biological activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GDF-9 Antibody (NBP2-61934)(1)

Publication using NBP2-61934

• Riepsamen AH, Chan K, Lien S, Sweeten P et Al. Serum Concentrations of Oocyte-Secreted Factors BMP15 and GDF9 During IVF and in Women With Reproductive Pathologies Endocrinology 2019-06-19 [PMID: 31211369]

Bioinformatics

• Gene Symbol: GDF9