Periaxin Antibody


Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human lung shows strong membranous positivity in pneumocytes.
Immunohistochemistry-Frozen: Periaxin Antibody [NBP1-89598] - Staining of Periaxin in mouse sciatic nerve using anti-Periaxin antibody (green). Image from verified customer review.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Analysis in human lung and liver tissues. Corresponding PRX RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Product Details

Reactivity Hu, Mu, CaSpecies Glossary
Applications ICC/IF, IHC, IHC-Fr, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Periaxin Antibody Summary

Specificity of human Periaxin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Frozen 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity reported in (PMID: 26196511). Periaxin antibody validated for IHC-F from a verified customer review.
Control Peptide
Periaxin Protein (NBP1-89598PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-89598 in the following applications:

Read Publication using
NBP1-89598 in the following applications:

Reactivity Notes

Canine reactivity reported in scientific literature (PMID: 26196511). Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Periaxin Antibody

  • CMT4F
  • PRX


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po
Applications: WB, ICC/IF
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr
Species: Hu, Bv
Applications: WB, DB, ELISA, S-ELISA

Publications for Periaxin Antibody (NBP1-89598)(1)

We have publications tested in 1 confirmed species: Canine.

We have publications tested in 2 applications: ICC/IF, IHC.

Filter By Application
All Applications
Filter By Species
All Species

Review for Periaxin Antibody (NBP1-89598) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-89598:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen Periaxin NBP1-89598
reviewed by:
Markus Tammia
IHC-Fr Mouse 07/13/2015


Sample TestedMouse sciatic nerve

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Periaxin Antibody (NBP1-89598). (Showing 1 - 1 of 1 FAQ).

  1. Could you tell me if you expect the periaxin antibody NBP1-89598 to react with rat tissue?
    • This antibody has not been tested in rat. I performed a blast homology comparison to Rat with the immunogen and found only a 69% homology. However this has been validated in Mouse and Mouse only has a 72% homology and it seems to work fine. Mouse and rat are 92% homologous. The problem is that we cannot guarantee the antibody will work in rat but we can presume it will. This antibody was developed against Recombinant Protein corresponding to amino acids: MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPSVELDL

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Periaxin Products

Bioinformatics Tool for Periaxin Antibody (NBP1-89598)

Discover related pathways, diseases and genes to Periaxin Antibody (NBP1-89598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Periaxin Antibody (NBP1-89598)

Discover more about diseases related to Periaxin Antibody (NBP1-89598).

Pathways for Periaxin Antibody (NBP1-89598)

View related products by pathway.

PTMs for Periaxin Antibody (NBP1-89598)

Learn more about PTMs related to Periaxin Antibody (NBP1-89598).

Blogs on Periaxin

There are no specific blogs for Periaxin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Markus Tammia
Application: IHC-Fr
Species: Mouse


Gene Symbol PRX