Periaxin Antibody

Images

 
Immunohistochemistry-Frozen: Periaxin Antibody [NBP1-89598] - Staining of Periaxin in mouse sciatic nerve using anti-Periaxin antibody (green). Image from verified customer review.
Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, CaSpecies Glossary
Applications IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Periaxin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPSVELDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Periaxin Protein (NBP1-89598PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89598 in the following applications:

Publications
Read Publication using
NBP1-89598 in the following applications:

Reactivity Notes

Canine reactivity reported in scientific literature (PMID: 26196511).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Periaxin Antibody

  • CMT4F
  • PRX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-13816
Species: Hu
Applications: WB, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051450-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-19777
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP1-36991
Species: Hu
Applications: WB, PEP-ELISA
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-13283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBL1-15012
Species: Hu
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Periaxin Antibody (NBP1-89598)(1)

We have publications tested in 1 confirmed species: Canine.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Canine
(1)
All Species

Review for Periaxin Antibody (NBP1-89598) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: IHC-Fr.

Reviews using NBP1-89598:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen Periaxin NBP1-89598
Enlarge
reviewed by:
Markus Tammia
IHC-Fr Mouse 07/13/2015
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedMouse sciatic nerve
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Periaxin Antibody (NBP1-89598) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Periaxin Products

Periaxin NBP1-89598

Bioinformatics Tool for Periaxin Antibody (NBP1-89598)

Discover related pathways, diseases and genes to Periaxin Antibody (NBP1-89598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Periaxin Antibody (NBP1-89598)

Discover more about diseases related to Periaxin Antibody (NBP1-89598).
 

Pathways for Periaxin Antibody (NBP1-89598)

View related products by pathway.

PTMs for Periaxin Antibody (NBP1-89598)

Learn more about PTMs related to Periaxin Antibody (NBP1-89598).

Blogs on Periaxin

There are no specific blogs for Periaxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Markus Tammia
07/13/2015
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol PRX