GCSH Antibody - Azide and BSA Free

Western Blot: GCSH Antibody - Azide and BSA Free [GCSH] - Western blot analysis of various lysates, using GCSH Rabbit pAb at 1:700 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: GCSH Antibody - Azide and BSA Free [GCSH] - Confocal immunofluorescence analysis of U2OS cells using GCSH Rabbit pAb at dilution of 1:100 (60x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: GCSH Antibody - Azide and BSA Free [GCSH] - Immunofluorescence analysis of L929 cells using GCSH Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: GCSH Antibody - Azide and BSA Free [GCSH] - Immunofluorescence analysis of C6 cells using GCSH Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: GCSH Antibody - Azide and BSA Free [GCSH] - Immunofluorescence analysis of U-2 OS cells using GCSH Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GCSH Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit GCSH Antibody - Azide and BSA Free (NBP3-04472) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human GCSH (NP_004474.2). MALRVVRSVRALLCTLRAVPSPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCSH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 18 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for GCSH Antibody - Azide and BSA Free

• GCE
• glycine cleavage system H protein, mitochondrial
• glycine cleavage system protein H (aminomethyl carrier)
• lipoic acid-containing protein
• mitochondrial glycine cleavage system H-protein
• NKH

Background

The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to themitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase;MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also callednonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GCSH