GCM1 Antibody - BSA Free

Western Blot: GCM1 Antibody [NBP3-10402] - Western blot analysis of GCM1 in Mouse Heart as a positive control. Antibody dilution at 0.2-1 ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GCM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GCM1 Antibody - BSA Free (NBP3-10402) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse GCM1 (NP_032129). Peptide sequence EDPTSTLDSMKFYERCKFSSSRIYGSEEQFQPPVPGTYGDYEDLQTWNKN
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GCM1 Antibody - BSA Free

• GCM motif protein 1
• GCMA
• glial cells missing (Drosophila) homolog a
• glial cells missing homolog 1 (Drosophila)
• Glial cells missing homolog 1
• hGCMachorion-specific transcription factor GCMa

Background

GCM1 encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GCM1