GBE1 Antibody


Western Blot: GBE1 Antibody [NBP1-85875] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GBE1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVP
Specificity of human, mouse, rat GBE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GBE1 Protein (NBP1-85875PEP)
Reviewed Applications
Read 1 Review rated 4
NBP1-85875 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GBE1 Antibody

  • 1,4-alpha-glucan-branching enzyme
  • amylo-(1,4 to 1,6) transglucosidase
  • amylo-(1,4 to 1,6) transglycosylase
  • Brancher enzyme
  • EC
  • GBE
  • glucan (1,4-alpha), branching enzyme 1
  • glycogen branching enzyme
  • Glycogen-branching enzyme


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GBE1 Antibody (NBP1-85875) (0)

There are no publications for GBE1 Antibody (NBP1-85875).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for GBE1 Antibody (NBP1-85875) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using NBP1-85875:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
reviewed by:
WB Other 05/30/2015


ApplicationWestern Blot
Sample Testedhela whole cell lysate, primary hepatocyte lysate


Blocking DetailsOdyssey blocking buffer, 2 hours, RT

Primary Anitbody

Dilution Ratio1:500, incubated overnoght at 4 degrees in Odyssey buffer

Secondary Antibody

Secondary DescriptionGoat anti rabbit, IRD
Secondary Concentration1:10000


Detection NotesFluorescent detection

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GBE1 Antibody (NBP1-85875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GBE1 Products

Bioinformatics Tool for GBE1 Antibody (NBP1-85875)

Discover related pathways, diseases and genes to GBE1 Antibody (NBP1-85875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBE1 Antibody (NBP1-85875)

Discover more about diseases related to GBE1 Antibody (NBP1-85875).

Pathways for GBE1 Antibody (NBP1-85875)

View related products by pathway.

Blogs on GBE1

There are no specific blogs for GBE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Other


Gene Symbol GBE1