After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.
Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human testis.
Independent Antibodies: Western Blot: GBE1 Antibody [NBP1-85875] - Analysis using Anti-GBE1 antibody NBP1-85875 (A) shows similar pattern to independent antibody NBP1-85877 (B).
Independent Antibodies: Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human colon, kidney, liver and testis using Anti-GBE1 antibody NBP1-85875 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human liver.
Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human kidney.
Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human colon.
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
This antibody was developed against Recombinant Protein corresponding to amino acids: GENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GBE1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for GBE1 Antibody - BSA Free
1,4-alpha-glucan-branching enzyme
amylo-(1,4 to 1,6) transglucosidase
amylo-(1,4 to 1,6) transglycosylase
Brancher enzyme
EC 2.4.1.18
GBE
glucan (1,4-alpha), branching enzyme 1
glycogen branching enzyme
Glycogen-branching enzyme
Background
GBE1 is encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersen's disease).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.