GBE1 Antibody

Images

 
Western Blot: GBE1 Antibody [NBP1-85875] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GBE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GBE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GBE1 Protein (NBP1-85875PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-85875 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GBE1 Antibody

  • 1,4-alpha-glucan-branching enzyme
  • amylo-(1,4 to 1,6) transglucosidase
  • amylo-(1,4 to 1,6) transglycosylase
  • Brancher enzyme
  • EC 2.4.1.18
  • GBE
  • glucan (1,4-alpha), branching enzyme 1
  • glycogen branching enzyme
  • Glycogen-branching enzyme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-42173
Species: Hu
Applications: WB, ICC/IF, ICC
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
H00007957-M02
Species: Hu, Rt
Applications: WB, ELISA
NBP1-89440
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-85875
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GBE1 Antibody (NBP1-85875) (0)

There are no publications for GBE1 Antibody (NBP1-85875).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for GBE1 Antibody (NBP1-85875) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Other.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-85875:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Other 05/30/2015
View

Summary

ApplicationWestern Blot
Sample Testedhela whole cell lysate, primary hepatocyte lysate
SpeciesOther

Blocking

Blocking DetailsOdyssey blocking buffer, 2 hours, RT

Primary Anitbody

Dilution Ratio1:500, incubated overnoght at 4 degrees in Odyssey buffer

Secondary Antibody

Secondary DescriptionGoat anti rabbit, IRD
Secondary Concentration1:10000

Details

Detection NotesFluorescent detection

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GBE1 Antibody (NBP1-85875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GBE1 Products

Bioinformatics Tool for GBE1 Antibody (NBP1-85875)

Discover related pathways, diseases and genes to GBE1 Antibody (NBP1-85875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBE1 Antibody (NBP1-85875)

Discover more about diseases related to GBE1 Antibody (NBP1-85875).
 

Pathways for GBE1 Antibody (NBP1-85875)

View related products by pathway.

Blogs on GBE1

There are no specific blogs for GBE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Anonymous
05/30/2015
Application: WB
Species: Other

Bioinformatics

Gene Symbol GBE1