Laforin/EPM2A Antibody (6C6)

Images

 
Western Blot: Laforin/EPM2A Antibody (6C6) [H00007957-M02] - EPM2A monoclonal antibody (M02), clone 6C6 Analysis of EPM2A expression in PC-12.
Western Blot: Laforin/EPM2A Antibody (6C6) [H00007957-M02] - Analysis of EPM2A expression in transfected 293T cell line by EPM2A monoclonal antibody (M02), clone 6C6.Lane 1: EPM2A transfected lysate(37.2 KDa).Lane 2: ...read more
Sandwich ELISA: Laforin/EPM2A Antibody (6C6) [H00007957-M02] - Detection limit for recombinant GST tagged EPM2A is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
6C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Laforin/EPM2A Antibody (6C6) Summary

Immunogen
EPM2A (NP_001018051, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV
Specificity
EPM2A - epilepsy, progressive myoclonus type 2A, Lafora disease (laforin)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EPM2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00007957-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Laforin/EPM2A Antibody (6C6)

  • EC 3.1.3.16
  • EC 3.1.3.48
  • epilepsy, progressive myoclonus type 2, Lafora disease (laforin)
  • epilepsy, progressive myoclonus type 2A, Lafora disease (laforin)
  • EPM2
  • EPM2A
  • Lafora PTPase
  • Laforin
  • LAFPTPase
  • LD
  • LDE
  • MELF

Background

This gene encodes a dual-specificity phosphatase that associates with polyribosomes. The encoded protein may be involved in the regulation of glycogen metabolism. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. Alternative splicing results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94901
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF6989
Species: Mu
Applications: IHC
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-87236
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00079660-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP2-03092
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00005564-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF1408
Species: Hu, Rt
Applications: IHC, IP, KO, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP2-75440
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for Laforin/EPM2A Antibody (H00007957-M02)(9)

We have publications tested in 1 confirmed species: Mouse.


Filter By Application
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00007957-M02 Applications Species
Liu Q, Li J, Zhang W Et al. Glycogen accumulation and phase separation drives liver tumor initiation Cell Oct 28 2021 [PMID: 34678143] (Mouse) Mouse
Irimia JM, Tagliabracci VS, Meyer CM et al. Muscle glycogen remodeling and glycogen phosphate metabolism following exhaustive exercise of wild type and laforin knockout mice. J Biol Chem. 2015 Jul 27 [PMID: 26216881]
Zhu Y, Zhang M, Kelly AR, Cheng A. The carbohydrate-binding domain of overexpressed STBD1 is important for its stability and protein-protein interactions. Biosci Rep. 2014 May 18 [PMID: 24837458]
Sherwood AR, Johnson MB, Delgado-Escueta AV, Gentry MS. A Bioassay for Lafora Disease and Laforin Glucan Phosphatase Activity. Clin Biochem. 2013 Sep 06 [PMID: 24012855]
Turnbull J, Girard JM, Lohi H et al. Early-onset Lafora body disease. Brain. 2012 Sep 01 [PMID: 22961547]
Tiberia E, Turnbull J, Wang T et al. Increased Laforin and Laforin Binding to Glycogen Underlie Lafora Body Formation in Malin-deficient Lafora Disease. J Biol Chem. 2012 Jun 05 [PMID: 22669944]
Depaoli-Roach AA, Segvich DM, Meyer CM et al. LAFORIN AND MALIN KNOCKOUT MICE HAVE NORMAL GLUCOSE DISPOSAL AND INSULIN SENSITIVITY. Hum Mol Genet. 2012 Jan 04 [PMID: 22186021]
Turnbull J, Wang P, Girard JM et al. Glycogen hyperphosphorylation underlies lafora body formation. Ann Neurol. 2010 Oct 28 [PMID: 21077101]
Tagliabracci VS, Turnbull J, Wang W et al. Laforin is a glycogen phosphatase, deficiency of which leads to elevated phosphorylation of glycogen in vivo. Proc Natl Acad Sci U S A. 2007 Nov 26 [PMID: 18040046]

Reviews for Laforin/EPM2A Antibody (H00007957-M02) (0)

There are no reviews for Laforin/EPM2A Antibody (H00007957-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laforin/EPM2A Antibody (H00007957-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Laforin/EPM2A Products

Bioinformatics Tool for Laforin/EPM2A Antibody (H00007957-M02)

Discover related pathways, diseases and genes to Laforin/EPM2A Antibody (H00007957-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laforin/EPM2A Antibody (H00007957-M02)

Discover more about diseases related to Laforin/EPM2A Antibody (H00007957-M02).
 

Pathways for Laforin/EPM2A Antibody (H00007957-M02)

View related products by pathway.

PTMs for Laforin/EPM2A Antibody (H00007957-M02)

Learn more about PTMs related to Laforin/EPM2A Antibody (H00007957-M02).
 

Research Areas for Laforin/EPM2A Antibody (H00007957-M02)

Find related products by research area.

Blogs on Laforin/EPM2A

There are no specific blogs for Laforin/EPM2A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laforin/EPM2A Antibody (6C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol EPM2A
Entrez
OMIM
Uniprot