AGL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AGL Antibody [NBP1-89440] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: AGL Antibody [NBP1-89440] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVYLRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYMLDAARNLQPNLYVVAELFTGSEDLDNVFVTRLGISSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AGL Protein (NBP1-89440PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGL Antibody

  • amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
  • GDEamylo-1, 6-glucosidase, 4-alpha-glucanotransferase
  • Glycogen debrancher
  • glycogen debranching enzyme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-07799
Species: Hu
NBP2-54724
Species: Hu
Applications: WB, IHC-P
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-02245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005554-R02
Species: Hu
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-89440
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for AGL Antibody (NBP1-89440) (0)

There are no publications for AGL Antibody (NBP1-89440).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGL Antibody (NBP1-89440) (0)

There are no reviews for AGL Antibody (NBP1-89440). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AGL Antibody (NBP1-89440) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AGL Products

Bioinformatics Tool for AGL Antibody (NBP1-89440)

Discover related pathways, diseases and genes to AGL Antibody (NBP1-89440). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGL Antibody (NBP1-89440)

Discover more about diseases related to AGL Antibody (NBP1-89440).
 

Pathways for AGL Antibody (NBP1-89440)

View related products by pathway.

PTMs for AGL Antibody (NBP1-89440)

Learn more about PTMs related to AGL Antibody (NBP1-89440).

Blogs on AGL

There are no specific blogs for AGL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGL
Entrez