GATA-5 Antibody - BSA Free

Western Blot: GATA-5 Antibody [NBP3-10463] - Western blot analysis using NBP3-10463 on Mouse Thymus as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GATA-5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GATA-5 Antibody - BSA Free (NBP3-10463) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_032119). Peptide sequence MYQSLALAQSPGQGTYADSGAFLHSSGTGSPVFVAPTRMPSMLPYLPSCE
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GATA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GATA-5 Antibody - BSA Free

• bB379O24.1
• GATA binding factor-5
• GATA binding protein 5
• GATA5
• GATA-5
• GATA-binding factor 5
• GATA-binding protein 5
• transcription factor GATA-5

Background

GATA5 is encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GATA5