Recombinant Human GATA-3 Protein

Images

 
SDS-Page: Recombinant Human GATA-3 Protein [H00002625-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human GATA-3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_002042.1) for Human GATA-3

Source: Wheat Germ

Amino Acid Sequence: TPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFG 169-248

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
GATA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GATA-3 Protein

  • 131320
  • GATA binding protein 3
  • GATA3
  • GATA-3
  • GATA-binding factor 3
  • GATA-binding protein 3
  • HDRMGC5199
  • MGC2346
  • MGC5445
  • trans-acting T-cell-specific transcription factor GATA-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

6507-IL/CF
Species: Hu
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2046
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
H00002625-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for GATA-3 Recombinant Protein (H00002625-Q01) (0)

There are no publications for GATA-3 Recombinant Protein (H00002625-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-3 Recombinant Protein (H00002625-Q01) (0)

There are no reviews for GATA-3 Recombinant Protein (H00002625-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATA-3 Recombinant Protein (H00002625-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for GATA-3 Recombinant Protein (H00002625-Q01)

Discover related pathways, diseases and genes to GATA-3 Recombinant Protein (H00002625-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATA-3 Recombinant Protein (H00002625-Q01)

Discover more about diseases related to GATA-3 Recombinant Protein (H00002625-Q01).
 

Pathways for GATA-3 Recombinant Protein (H00002625-Q01)

View related products by pathway.

PTMs for GATA-3 Recombinant Protein (H00002625-Q01)

Learn more about PTMs related to GATA-3 Recombinant Protein (H00002625-Q01).
 

Research Areas for GATA-3 Recombinant Protein (H00002625-Q01)

Find related products by research area.

Blogs on GATA-3

There are no specific blogs for GATA-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4
6507-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GATA-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA3