Gas6 Antibody

Images

 
Western Blot: Gas6 Antibody [NBP1-90059] - Analysis in control (vector only transfected HEK293T lysate) and gAS6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Gas6 Antibody [NBP1-90059] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: Gas6 Antibody [NBP1-90059] - Staining in human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gas6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAS6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Gas6 Protein (NBP1-90059PEP)
Publications
Read Publication using NBP1-90059.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23361052)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Gas6 Antibody

  • AXLLG
  • AXLLGAXL stimulatory factor
  • AXSFAXL receptor tyrosine kinase ligand
  • DKFZp666G247
  • FLJ34709
  • Gas6
  • GAS-6
  • growth arrest-specific 6
  • growth arrest-specific protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF154
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, KO
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-28635
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC-P, IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Gas6 Antibody (NBP1-90059)(1)

Reviews for Gas6 Antibody (NBP1-90059) (0)

There are no reviews for Gas6 Antibody (NBP1-90059). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gas6 Antibody (NBP1-90059) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gas6 Products

Bioinformatics Tool for Gas6 Antibody (NBP1-90059)

Discover related pathways, diseases and genes to Gas6 Antibody (NBP1-90059). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gas6 Antibody (NBP1-90059)

Discover more about diseases related to Gas6 Antibody (NBP1-90059).
 

Pathways for Gas6 Antibody (NBP1-90059)

View related products by pathway.

PTMs for Gas6 Antibody (NBP1-90059)

Learn more about PTMs related to Gas6 Antibody (NBP1-90059).

Blogs on Gas6

There are no specific blogs for Gas6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gas6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAS6
Entrez