gamma-glutamyl hydrolase Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit gamma-glutamyl hydrolase Antibody - BSA Free (NBP2-87485) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of gamma-glutamyl hydrolase. Peptide sequence: DGISHAPNAVKTAFYLAEFFVNEARKNNHHFKSESEEEKALIYQFSPIYT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GGH |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for gamma-glutamyl hydrolase Antibody - BSA Free
Background
The gamma-glutamyl hydrolase gene catalyzes the hydrolysis of folylpoly-gamma-glutamates and antifolylpoly-gamma-glutamates by the removal of gamma-linked polyglutamates and glutamate. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Publications for gamma-glutamyl hydrolase Antibody (NBP2-87485) (0)
There are no publications for gamma-glutamyl hydrolase Antibody (NBP2-87485).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for gamma-glutamyl hydrolase Antibody (NBP2-87485) (0)
There are no reviews for gamma-glutamyl hydrolase Antibody (NBP2-87485).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for gamma-glutamyl hydrolase Antibody (NBP2-87485) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional gamma-glutamyl hydrolase Products
Research Areas for gamma-glutamyl hydrolase Antibody (NBP2-87485)
Find related products by research area.
|
Blogs on gamma-glutamyl hydrolase