GALK1 Antibody (2E9.)

Images

 
Sandwich ELISA: GALK1 Antibody (2E9) [H00002584-M01] - Detection limit for recombinant GST tagged GALK1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E9.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GALK1 Antibody (2E9.) Summary

Immunogen
GALK1 (NP_000145, 181 a.a. - 279 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRAR
Specificity
GALK1 - galactokinase 1 (2E9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GALK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GALK1 Antibody (2E9.)

  • EC 2.7.1.6
  • galactokinase 1
  • galactokinase
  • Galactose kinase
  • GALK
  • GK1

Background

Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002592-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-87066
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-48900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57033
Species: Hu
Applications: WB
H00002584-M01
Species: Hu
Applications: WB, ELISA

Publications for GALK1 Antibody (H00002584-M01) (0)

There are no publications for GALK1 Antibody (H00002584-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALK1 Antibody (H00002584-M01) (0)

There are no reviews for GALK1 Antibody (H00002584-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GALK1 Antibody (H00002584-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GALK1 Products

Bioinformatics Tool for GALK1 Antibody (H00002584-M01)

Discover related pathways, diseases and genes to GALK1 Antibody (H00002584-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALK1 Antibody (H00002584-M01)

Discover more about diseases related to GALK1 Antibody (H00002584-M01).
 

Pathways for GALK1 Antibody (H00002584-M01)

View related products by pathway.

Blogs on GALK1

There are no specific blogs for GALK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GALK1 Antibody (2E9.) and receive a gift card or discount.

Bioinformatics

Gene Symbol GALK1
Entrez
Uniprot