Galectin-4 Recombinant Protein Antigen

Images

 
There are currently no images for Galectin-4 Recombinant Protein Antigen (NBP2-48607PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Galectin-4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Galectin-4.

Source: E. coli

Amino Acid Sequence: IALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LGALS4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48607.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Galectin-4 Recombinant Protein Antigen

  • Antigen NY-CO-27
  • GAL4
  • gal-4
  • galectin 4
  • Galectin4
  • Galectin-4
  • L-36 lactose-binding protein
  • L36LBP
  • Lactose-binding lectin 4
  • lectin, galactoside-binding, soluble, 4
  • LGALS4

Background

Galectins are a family of soluble beta-galactoside-binding animal lectins that modulate cell-to-cell adhesion and cell-to-extracellular matrix (ECM) interactions and play a role in tumor progression, pre-mRNA splicing and apoptosis. One member of this family, Galectin-4, also known as Gal-4, L36 or LGALS4 maps to human chromosome 19q13.13 and encodes a 36-37 kDa protein. The Galectin-4 protein is composed of 323 amino acids and contains two homologous carbohydrate recognition domains (CRD) and all amino acids typically conserved in the galectin family. Expression of Galectin-4 correlates with the malignant potential of human hepatocellular carcinoma (HCC) and is differentially regulated depending on cell-cell contact, serum growth factors, cell growth and cell differentiation status. Galectin-4 expression is detected in epithelial cells of the colon, rectum, intestine, and in HT29 and LS174T cell lines. Galectin-4 is underexpressed in colorectal cancer and is preferentially upregulated in cells prone to peritoneal dissemination.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-82693
Species: Hu
Applications: IHC,  IHC-P, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF1197
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-90364
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-48607PEP
Species: Hu
Applications: AC

Publications for Galectin-4 Recombinant Protein Antigen (NBP2-48607PEP) (0)

There are no publications for Galectin-4 Recombinant Protein Antigen (NBP2-48607PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-4 Recombinant Protein Antigen (NBP2-48607PEP) (0)

There are no reviews for Galectin-4 Recombinant Protein Antigen (NBP2-48607PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Galectin-4 Recombinant Protein Antigen (NBP2-48607PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Galectin-4 Products

Research Areas for Galectin-4 Recombinant Protein Antigen (NBP2-48607PEP)

Find related products by research area.

Blogs on Galectin-4

There are no specific blogs for Galectin-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Galectin-4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LGALS4