Galectin-14/LGALS14 Antibody

Images

 
Western Blot: Galectin-14/LGALS14 Antibody [NBP1-57683] - Human Stomach, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Galectin-14/LGALS14 Antibody Summary

Immunogen
Synthetic peptides corresponding to LGALS14(lectin, galactoside-binding, soluble, 14) The peptide sequence was selected from the N terminal of LGALS14. Peptide sequence MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LGALS14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LGALS14 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Galectin-14/LGALS14 Antibody

  • Charcot-Leyden crystal protein 2
  • CLC2
  • CLC2placental protein 13-like protein
  • Gal-14
  • Galectin14
  • Galectin-14
  • lectin, galactoside-binding, soluble, 14
  • LGALS14
  • MGC22235
  • PPL13
  • PPL13placental protein 13-like

Background

This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternativel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
AF1305
Species: Hu
Applications: WB, Simple Western, IHC
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
AF2045
Species: Hu
Applications: WB, IHC, ICC
NBP2-53210
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PAGE
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF4254
Species: Hu
Applications: WB, IHC, ICC
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-30954
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57683
Species: Hu
Applications: WB

Publications for Galectin-14/LGALS14 Antibody (NBP1-57683) (0)

There are no publications for Galectin-14/LGALS14 Antibody (NBP1-57683).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-14/LGALS14 Antibody (NBP1-57683) (0)

There are no reviews for Galectin-14/LGALS14 Antibody (NBP1-57683). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Galectin-14/LGALS14 Antibody (NBP1-57683) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Galectin-14/LGALS14 Products

Bioinformatics Tool for Galectin-14/LGALS14 Antibody (NBP1-57683)

Discover related pathways, diseases and genes to Galectin-14/LGALS14 Antibody (NBP1-57683). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Galectin-14/LGALS14

There are no specific blogs for Galectin-14/LGALS14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Galectin-14/LGALS14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LGALS14
Entrez
Uniprot