Recombinant Human GAL3ST1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GAL3ST1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 324-423 of Human GAL3ST1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RERMAREVAALRHANERMRTICIDGGHAVDAAAIQDEAMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWVTKLWKFIRDFLRW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GAL3ST1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GAL3ST1 Protein

  • 3'-phosphoadenosine-5'-phosphosulfate:GalCer sulfotransferase
  • 3'-phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase
  • cerebroside (3'-phosphoadenylylsulfate:galactosylceramide 3') sulfotransferase
  • CSTCerebroside sulfotransferase
  • EC 2.8.2.11
  • galactose-3-O-sulfotransferase 1
  • galactosylceramide sulfotransferase
  • GalCer sulfotransferase

Background

GAL3ST1 - galactose-3-O-sulfotransferase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001325-P01
Species: Hu
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
MAB5826
Species: Hu
Applications: WB, IHC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
AF1436
Species: Mu
Applications: WB
MAB4727
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
H00009514-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GAL3ST1 Partial Recombinant Protein (H00009514-Q01) (0)

There are no publications for GAL3ST1 Partial Recombinant Protein (H00009514-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAL3ST1 Partial Recombinant Protein (H00009514-Q01) (0)

There are no reviews for GAL3ST1 Partial Recombinant Protein (H00009514-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAL3ST1 Partial Recombinant Protein (H00009514-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GAL3ST1 Products

Bioinformatics Tool for GAL3ST1 Partial Recombinant Protein (H00009514-Q01)

Discover related pathways, diseases and genes to GAL3ST1 Partial Recombinant Protein (H00009514-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAL3ST1 Partial Recombinant Protein (H00009514-Q01)

Discover more about diseases related to GAL3ST1 Partial Recombinant Protein (H00009514-Q01).
 

Pathways for GAL3ST1 Partial Recombinant Protein (H00009514-Q01)

View related products by pathway.

Blogs on GAL3ST1

There are no specific blogs for GAL3ST1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
GAL3ST1 Antibody
NBP1-85431
NT-3 [Unconjugated]
267-N3-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GAL3ST1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GAL3ST1