![Western Blot: GABARAP Antibody (5T6W5) [NBP3-16376] - Western blot analysis of extracts of various cell lines, using GABARAP Rabbit mAb (NBP3-16376) at 1:1000 dilution.293T cells were treated by Chloroquine (50 uM) at 37C for 20 hours. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% BSA. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/GABARAP-Antibody-5T6W5-Western-Blot-NBP3-16376-img0001.jpg "Western Blot: GABARAP Antibody (5T6W5) [NBP3-16376] - Western blot analysis of extracts of various cell lines, using GABARAP Rabbit mAb (NBP3-16376) at 1:1000 dilution.293T cells were treated by Chloroquine (50 uM) at 37C for 20 hours. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% BSA. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB |
| Clone | 5T6W5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit GABARAP Antibody (5T6W5) (NBP3-16376) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (O95166). MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | GABARAP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Immunohistochemistry_10631.jpg)
![Simple Western ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Simple_Western_16409.jpg)
![Western Blot ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Western_Blot_11614.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for GABARAP Antibody (NBP3-16376)Find related products by research area.
|
|
Read full blog post. |
|
Breakdown: Interpreting LC3 Antibody WB Results In rodents, MAP1LC3 (Microtubule-associated protein 1 light chain 3) is expressed in the renal visceral epithelial cells, or podocytes. LC3 antibody analysis has shown the protein accumulates in its membrane-bound form, LC3II, following conversio... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GABARAP |
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")