GABA-A R delta Recombinant Protein Antigen

Images

 
There are currently no images for GABA-A R delta Protein (NBP2-33421PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GABA-A R delta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GABRD.

Source: E. coli

Amino Acid Sequence: KVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GABRD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33421.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GABA-A R delta Recombinant Protein Antigen

  • EIG10
  • EJM7
  • GABA A R delta
  • GABA(A) receptor subunit delta
  • GABA-A receptor, delta polypeptide
  • GABAAR delta
  • GABAARd
  • GABRD
  • gamma-aminobutyric acid (GABA) A receptor, delta
  • gamma-aminobutyric acid receptor subunit delta
  • GEFSP5
  • MGC45284

Background

Gamma-aminobutyric acid (GABA) is the primary inhibitory neurotransmitter in the central nervous system, causing a hyperpolarization of the membrane through the opening of a channel associated with the GABAA Receptor (GABAA-R) subtype. GABAA-Rs are important therapeutic targets for a range of sedative, anxiolytic, and hypnotic agents and are implicated in several diseases including epilepsy, anxiety, depression, and substance abuse. The GABAA-R is a multimeric subunit complex. To date six as, four bs and four gs, plus alternative splicing variants of some of these subunits, have been identified (Olsen and Tobin, 1990; Whiting et al., 1999; Ogris et al., 2004). Injection in oocytes or mammalian cell lines of cRNA coding for a- and b-subunits results in the expression of functional GABAA-Rs sensitive to GABA. However, coexpression of a g-subunit is required for benzodiazepine modulation. The various effects of the benzodiazepines in brain may also be mediated via different a-subunits of the receptor (McKernan et al., 2000; Mehta and Ticku, 1998; Ogris et al., 2004; P ltl et al., 2003). More recently there have been a number of studies demonstrating that the -subunit of the receptor may affect subunit assembly (Korpi et al., 2002) and may also confer differential sensitivity to neurosteroids and to ethanol (Wallner et al., 2003; Wohlfarth et al., 2002).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-190
Species: Hu, Mu, Rt
Applications: IHC, KD, WB
NBP2-94559
Species: Hu, Mu, Rt
Applications: WB
H00006326-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NB300-191
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87852
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB300-199
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-14040
Species: Hu
Applications: IHC, IHC-P, WB
DFN00
Species: Hu
Applications: ELISA
MAB8864
Species: Hu
Applications: IHC
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB5696
Species: Hu, Mu
Applications: WB

Publications for GABA-A R delta Protein (NBP2-33421PEP) (0)

There are no publications for GABA-A R delta Protein (NBP2-33421PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-A R delta Protein (NBP2-33421PEP) (0)

There are no reviews for GABA-A R delta Protein (NBP2-33421PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GABA-A R delta Protein (NBP2-33421PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GABA-A R delta Products

Bioinformatics Tool for GABA-A R delta Protein (NBP2-33421PEP)

Discover related pathways, diseases and genes to GABA-A R delta Protein (NBP2-33421PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA-A R delta Protein (NBP2-33421PEP)

Discover more about diseases related to GABA-A R delta Protein (NBP2-33421PEP).
 

Pathways for GABA-A R delta Protein (NBP2-33421PEP)

View related products by pathway.

PTMs for GABA-A R delta Protein (NBP2-33421PEP)

Learn more about PTMs related to GABA-A R delta Protein (NBP2-33421PEP).
 

Research Areas for GABA-A R delta Protein (NBP2-33421PEP)

Find related products by research area.

Blogs on GABA-A R delta

There are no specific blogs for GABA-A R delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GABA-A R delta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRD