GABA-A R delta Recombinant Protein Antigen

Images

 
There are currently no images for GABA-A R delta Protein (NBP2-33421PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GABA-A R delta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GABRD.

Source: E.coli

Amino Acid Sequence: KVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GABRD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33421.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GABA-A R delta Recombinant Protein Antigen

  • EIG10
  • EJM7
  • GABA A R delta
  • GABA(A) receptor subunit delta
  • GABA-A receptor, delta polypeptide
  • GABAAR delta
  • GABAARd
  • GABRD
  • gamma-aminobutyric acid (GABA) A receptor, delta
  • gamma-aminobutyric acid receptor subunit delta
  • GEFSP5
  • MGC45284

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-190
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-58876
Species: Hu
Applications: ICC/IF
H00006324-P01
Species: Hu
H00006326-Q01
Species: Hu
NB300-191
Species: Hu, Mu, Rt
Applications: WB
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB300-199
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IF, IHC-FrFl
NBP1-02161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1799
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow, KO
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
MAB8864
Species: Hu
Applications: IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P

Publications for GABA-A R delta Protein (NBP2-33421PEP) (0)

There are no publications for GABA-A R delta Protein (NBP2-33421PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-A R delta Protein (NBP2-33421PEP) (0)

There are no reviews for GABA-A R delta Protein (NBP2-33421PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GABA-A R delta Protein (NBP2-33421PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for GABA-A R delta Protein (NBP2-33421PEP)

Discover related pathways, diseases and genes to GABA-A R delta Protein (NBP2-33421PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA-A R delta Protein (NBP2-33421PEP)

Discover more about diseases related to GABA-A R delta Protein (NBP2-33421PEP).
 

Pathways for GABA-A R delta Protein (NBP2-33421PEP)

View related products by pathway.

PTMs for GABA-A R delta Protein (NBP2-33421PEP)

Learn more about PTMs related to GABA-A R delta Protein (NBP2-33421PEP).

Blogs on GABA-A R delta

There are no specific blogs for GABA-A R delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GABA-A R delta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRD