Fucosyltransferase 8/FUT8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Fucosyltransferase 8/FUT8 Antibody [NBP2-58933] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Fucosyltransferase 8/FUT8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRP
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FUT8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Fucosyltransferase 8/FUT8 Recombinant Protein Antigen (NBP2-58933PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Fucosyltransferase 8/FUT8 Antibody - BSA Free

• alpha 1,6 Fucosyltransferase
• alpha-(1,6)-fucosyltransferase
• alpha1-6FucT
• EC 2.4.1.68
• fucosyltransferase 8 (alpha (1,6) fucosyltransferase)
• Fucosyltransferase 8
• FUT8
• GDP-fucose--glycoprotein fucosyltransferase
• GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase
• Glycoprotein 6-alpha-L-fucosyltransferase
• MGC26465

Background

FUT8 belongs to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Fucosyltransferase 8/FUT8 Antibody (NBP2-58933)(1)

Publication using NBP2-58933

• Klingler F, Naumann L, Schlossbauer P et al. A novel system for glycosylation engineering by natural and artificial miRNAs Metabolic engineering 2023-03-09 [PMID: 36906118] (WB, Hamster)
  
  Details:
  Dilution used in WB 1:100

Bioinformatics

• Gene Symbol: FUT8