FSH beta Antibody - BSA Free

Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723] - Staining of human pituitary gland shows moderate to strong cytoplasmic positivity in glandular cells in anterior lobe.

Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FSH beta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FSHB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FSH beta Recombinant Protein Antigen (NBP2-57723PEP)

Reactivity Notes

Mouse 87%, Rat 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FSH beta Antibody - BSA Free

• follicle stimulating hormone, beta polypeptide
• Follicle-stimulating hormone beta subunit
• Follitropin beta chain
• follitropin subunit beta
• Follitropin
• follitropin, beta chain
• FSH beta
• FSHB
• FSH-B
• FSH-beta

Background

FSH is a pituitary hormone involved in the maturation of ovarian follicles and estrogen secretion in females. In the pituitary gland, FSH is produced by gonadotrophs. In males, FSH stimulates the secretion of testosterone. Follicle stimulating hormone enables ovarian folliculogenesis to the antral follicle stage and is essential for Sertoli cell proliferation and maintenance of sperm quality in the testis. Members of the pituitary glycoprotein hormone family, of which FSH is one (see also luteinizing hormone, chorionic gonadotropin, and thyroid stimulating hormone), consist of a shared alpha chain and a beta chain encoded by a separate gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FSHB