FRYL Antibody - BSA Free

Western Blot: FRYL Antibody [NBP1-94071] - Analysis in human cell line HEL.

Immunocytochemistry/Immunofluorescence: FRYL Antibody [NBP1-94071] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & microtubules.

Immunohistochemistry-Paraffin: FRYL Antibody [NBP1-94071] - Staining of human liver shows no positivity in hepatocytes as expected.

Western Blot: FRYL Antibody [NBP1-94071] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: FRYL Antibody [NBP1-94071] - Staining of human cerebral cortex shows moderate cytoplsmic positivity in neuropil.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Staining of human duodenum shows strong positivity in apical membrane in glandular cells.

Analysis in human cell line HEL.

Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FRYL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FRYL Antibody - BSA Free (NBP1-94071) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-FRYL Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FRYL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FRYL Protein (NBP1-94071PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FRYL Antibody - BSA Free

• AF4P12
• ALL1-fused gene from chromosome 4p12 protein
• DKFZp686E205
• FLJ16177
• FRY-like
• furry homolog-like
• furry-like
• KIAA0826
• protein furry homolog-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FRYL Antibody (NBP1-94071)(1)

Publication using NBP1-94071

• Rippe C, Zhu B, Krawczyk KK et al. Hypertension reduces soluble guanylyl cyclase expression in the mouse aorta via the Notch signaling pathway. Sci Rep 2017-05-02 [PMID: 28465505]
  
  Details:
  The anti-SRPX2 antibody NBP1-77370 from Novus was used to examine the effect of AngII and Nacl treatment on SPRX2 expression in mouse aortas

Bioinformatics

• Gene Symbol: FRYL