FRS3 Antibody - BSA Free

Western Blot: FRS3 Antibody [NBP1-52962] - DU145 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FRS3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FRS3(fibroblast growth factor receptor substrate 3) The peptide sequence was selected from the middle region of FRS3. Peptide sequence GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FRS3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FRS3 Antibody - BSA Free

• FGFR substrate 3
• FGFR-signaling adaptor SNT2
• fibroblast growth factor receptor substrate 3
• FRS2B
• FRS2beta
• FRS2-beta
• SNT2
• SNT-2MGC17167
• suc1-associated neurotrophic factor target 2 (FGFR signalling adaptor)
• Suc1-associated neurotrophic factor target 2

Background

FRS3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. FRS3 is involved in the activation of MAP kinases. FRS3 down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.The protein encoded by this gene is a substrate for the fibroblast growth factor receptor. It is found in peripheral plasma membrane and functions in linking FGF receptor stimulation to activators of Ras. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FRS3
• Uniprot:
  • O43559(Human)