FRS3 Antibody


Western Blot: FRS3 Antibody [NBP1-52962] - DU145 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FRS3 Antibody Summary

Synthetic peptides corresponding to FRS3(fibroblast growth factor receptor substrate 3) The peptide sequence was selected from the middle region of FRS3. Peptide sequence GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FRS3 and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FRS3 Antibody

  • FGFR substrate 3
  • FGFR-signaling adaptor SNT2
  • fibroblast growth factor receptor substrate 3
  • FRS2B
  • FRS2beta
  • FRS2-beta
  • SNT2
  • SNT-2MGC17167
  • suc1-associated neurotrophic factor target 2 (FGFR signalling adaptor)
  • Suc1-associated neurotrophic factor target 2


FRS3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. FRS3 is involved in the activation of MAP kinases. FRS3 down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.The protein encoded by this gene is a substrate for the fibroblast growth factor receptor. It is found in peripheral plasma membrane and functions in linking FGF receptor stimulation to activators of Ras. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu, Fe, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for FRS3 Antibody (NBP1-52962) (0)

There are no publications for FRS3 Antibody (NBP1-52962).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRS3 Antibody (NBP1-52962) (0)

There are no reviews for FRS3 Antibody (NBP1-52962). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FRS3 Antibody (NBP1-52962) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FRS3 Products

Bioinformatics Tool for FRS3 Antibody (NBP1-52962)

Discover related pathways, diseases and genes to FRS3 Antibody (NBP1-52962). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRS3 Antibody (NBP1-52962)

Discover more about diseases related to FRS3 Antibody (NBP1-52962).

Pathways for FRS3 Antibody (NBP1-52962)

View related products by pathway.

PTMs for FRS3 Antibody (NBP1-52962)

Learn more about PTMs related to FRS3 Antibody (NBP1-52962).

Research Areas for FRS3 Antibody (NBP1-52962)

Find related products by research area.

Blogs on FRS3

There are no specific blogs for FRS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FRS3 Antibody and receive a gift card or discount.


Gene Symbol FRS3