Frizzled-8 Antibody

Images

 
Western Blot: Frizzled-8 Antibody [NBP1-87410] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Frizzled-8 Antibody [NBP1-87410] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.
Western Blot: Frizzled-8 Antibody [NBP1-87410] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Frizzled-8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FZD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Frizzled-8 Protein (NBP1-87410PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Frizzled-8 Antibody

  • frizzled (Drosophila) homolog 8
  • frizzled 8
  • frizzled family receptor 8
  • frizzled homolog 8 (Drosophila)
  • Frizzled8
  • Frizzled-8
  • FZ-8
  • FZD8
  • hFZ8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1120
Species: Mu
Applications: WB, IHC
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
AF1617
Species: Hu
Applications: WB
AF198
Species: Mu
Applications: WB, IHC
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3149
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
MAB1001
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-23659
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
AF2248
Species: Mu
Applications: WB, IHC
645-WN/CF
Species: Hu, Mu
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2064
Species: Hu
Applications: WB, Simple Western
NBP2-46367
Species: Hu
Applications: WB, IHC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-87410
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Frizzled-8 Antibody (NBP1-87410) (0)

There are no publications for Frizzled-8 Antibody (NBP1-87410).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frizzled-8 Antibody (NBP1-87410) (0)

There are no reviews for Frizzled-8 Antibody (NBP1-87410). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Frizzled-8 Antibody (NBP1-87410) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Frizzled-8 Products

Bioinformatics Tool for Frizzled-8 Antibody (NBP1-87410)

Discover related pathways, diseases and genes to Frizzled-8 Antibody (NBP1-87410). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-8 Antibody (NBP1-87410)

Discover more about diseases related to Frizzled-8 Antibody (NBP1-87410).
 

Pathways for Frizzled-8 Antibody (NBP1-87410)

View related products by pathway.

PTMs for Frizzled-8 Antibody (NBP1-87410)

Learn more about PTMs related to Frizzled-8 Antibody (NBP1-87410).
 

Research Areas for Frizzled-8 Antibody (NBP1-87410)

Find related products by research area.

Blogs on Frizzled-8

There are no specific blogs for Frizzled-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frizzled-8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FZD8
Entrez