FoxH1 Antibody

Images

 
Western Blot: FoxH1 Antibody [H00008928-D01P] - Analysis of FOXH1 expression in transfected 293T cell line by FOXH1 polyclonal antibody.Lane 1: FOXH1 transfected lysate(40.15 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FoxH1 Antibody Summary

Immunogen
FOXH1 (AAI11605.1, 1 a.a. - 365 a.a.) full-length human protein. MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLLSWCSL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXH1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxH1 Antibody

  • FAST1
  • Fast-1
  • FAST1forkhead box protein H1
  • FAST2
  • Fast-2
  • Forkhead activin signal transducer 1
  • Forkhead activin signal transducer 2
  • forkhead activin signal transducer-1
  • forkhead box H1
  • FoxH1
  • hFAST-1
  • TGF-beta/activin signal transducer

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-31323
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80699
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
MAB7555
Species: Hu
Applications: WB, Simple Western
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-01926
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for FoxH1 Antibody (H00008928-D01P) (0)

There are no publications for FoxH1 Antibody (H00008928-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxH1 Antibody (H00008928-D01P) (0)

There are no reviews for FoxH1 Antibody (H00008928-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxH1 Antibody (H00008928-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxH1 Products

Bioinformatics Tool for FoxH1 Antibody (H00008928-D01P)

Discover related pathways, diseases and genes to FoxH1 Antibody (H00008928-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxH1 Antibody (H00008928-D01P)

Discover more about diseases related to FoxH1 Antibody (H00008928-D01P).
 

Pathways for FoxH1 Antibody (H00008928-D01P)

View related products by pathway.

PTMs for FoxH1 Antibody (H00008928-D01P)

Learn more about PTMs related to FoxH1 Antibody (H00008928-D01P).
 

Research Areas for FoxH1 Antibody (H00008928-D01P)

Find related products by research area.

Blogs on FoxH1

There are no specific blogs for FoxH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXH1
Entrez
Uniprot