FoxH1 Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
FOXH1 (AAI11605.1, 1 a.a. - 365 a.a.) full-length human protein. MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLLSWCSL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FOXH1 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for WB and Functional. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for FoxH1 Antibody - Azide and BSA Free
Background
Fas, also referred to as CD95 or APO-1, is a type I transmembrane protein that plays a central role mediating viral immunity. TIA-1 and TIAR are two closely related proteins that possess three RRMs (RNA recognition motifs), designated RRM 1, 2 and 3, respectively. Although both TIA-1 and TIAR are thought to function as mediators of apoptotic cell death, their specific roles in such pathways are unknown. Unlike TIA-1, which is found in the granules of cytotoxic lymphocytes, TIAR expression is limited to the nucleus and found in a much broader range of cells including, but not limited to, cells of hematopoietic origin. TIAR is translocated to the cytoplasm shortly after Fas ligation and this event immediately proceeds the onset of DNA fragmentation. A novel serine/ threonine kinase that is activated as a result of Fas ligation, designated FAST (Fas-activated serine/threonine), shows kinase specificity towards both TIA-1 and TIAR. In unstimulated Jurkat cells, FAST resides in the cytoplasm as a highly phosphorylated protein and is quickly dephosphorylated and activated in response to stimulated Fas.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Publications for FoxH1 Antibody (H00008928-D01P) (0)
There are no publications for FoxH1 Antibody (H00008928-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FoxH1 Antibody (H00008928-D01P) (0)
There are no reviews for FoxH1 Antibody (H00008928-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FoxH1 Antibody (H00008928-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FoxH1 Products
Research Areas for FoxH1 Antibody (H00008928-D01P)
Find related products by research area.
|
Blogs on FoxH1