Follistatin-related Gene Protein/FLRG/Fstl3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry: Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Follistatin-related Gene Protein/FLRG/Fstl3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FSTL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Follistatin-related Gene Protein/FLRG/Fstl3 Protein (NBP2-32034PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody

  • FLRG
  • FLRGFSRP
  • follistatin-like 3 (secreted glycoprotein)
  • Follistatin-like 3
  • Follistatin-like protein 3
  • Follistatin-related gene protein
  • follistatin-related protein 3
  • FSTL3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF2070
Species: Hu
Applications: WB, IP, Neut
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-83391
Species: Hu
Applications: IHC, IHC-P
AF339
Species: Hu
Applications: WB, IHC, Block
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
NBP2-32034
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034) (0)

There are no publications for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034) (0)

There are no reviews for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Follistatin-related Gene Protein/FLRG/Fstl3 Products

Bioinformatics Tool for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034)

Discover related pathways, diseases and genes to Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034)

Discover more about diseases related to Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034).
 

Pathways for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034)

View related products by pathway.

PTMs for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034)

Learn more about PTMs related to Follistatin-related Gene Protein/FLRG/Fstl3 Antibody (NBP2-32034).

Blogs on Follistatin-related Gene Protein/FLRG/Fstl3

There are no specific blogs for Follistatin-related Gene Protein/FLRG/Fstl3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Follistatin-related Gene Protein/FLRG/Fstl3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FSTL3
Entrez
Uniprot