FOCAD Antibody

Images

 
Immunohistochemistry: FOCAD Antibody [NBP2-49163] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FOCAD Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NWAALLSPLMRLNFGEEIQQLCLEIMVTQAQSSQNAAALLGLWVTPPLIHSLSLNTKRYLLISAPLWIKHISDEQILGFVENLMVAVFKAASPLGSPELCPSALHGLSQAMKLPSPAHHLWSLLSEA
Specificity
Specificity of human FOCAD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOCAD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FOCAD Recombinant Protein Antigen (NBP2-49163PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FOCAD Antibody

  • Focadhesin
  • KIAA1797

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP2-48652
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48527
Species: Hu
Applications: WB, IHC, IHC-P
AF5129
Species: Hu
Applications: WB
NBP2-58159
Species: Hu
Applications: ICC/IF
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-33470
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00060485-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA, RIA
NBP1-59658
Species: Hu
Applications: WB
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC
NBP1-69123
Species: Hu, Mu, Rt
Applications: WB
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47579
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC, IF

Publications for FOCAD Antibody (NBP2-49163) (0)

There are no publications for FOCAD Antibody (NBP2-49163).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOCAD Antibody (NBP2-49163) (0)

There are no reviews for FOCAD Antibody (NBP2-49163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FOCAD Antibody (NBP2-49163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-49163

Bioinformatics Tool for FOCAD Antibody (NBP2-49163)

Discover related pathways, diseases and genes to FOCAD Antibody (NBP2-49163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOCAD Antibody (NBP2-49163)

Discover more about diseases related to FOCAD Antibody (NBP2-49163).
 

Pathways for FOCAD Antibody (NBP2-49163)

View related products by pathway.

Blogs on FOCAD

There are no specific blogs for FOCAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOCAD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOCAD