CLCN5 Antibody


Western Blot: CLCN5 Antibody [NBP1-69123] - Rat Brain Antibody Dilution: 1.0 ug/ml
Western Blot: CLCN5 Antibody [NBP1-69123] - Mouse Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: CLCN5 Antibody [NBP1-69123] - Rat Liver. Antibody Dilution: 1.0 ug/ml.
Western Blot: CLCN5 Antibody [NBP1-69123] - Sample Type: Mouse Brain Antibody Dilution: 1.0ug/ml
Western Blot: CLCN5 Antibody [NBP1-69123] - Sample Type: Mouse Heart Antibody Dilution: 1.0ug/ml
Western Blot: CLCN5 Antibody [NBP1-69123] - Sample Type: Mouse Kidney Antibody Dilution: 1.0ug/ml
Western Blot: CLCN5 Antibody [NBP1-69123] - Rat Lung Antibody Dilution: 1.0 ug/ml
Western Blot: CLCN5 Antibody [NBP1-69123] - Rat Muscle Antibody Dilution: 1.0 ug/ml

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB

Order Details

CLCN5 Antibody Summary

Synthetic peptides corresponding to Clcn5 (chloride channel 5) The peptide sequence was selected from the middle region of Clcn5. Peptide sequence LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Clcn5 and was validated on Western blot.
Theoretical MW
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CLCN5 Antibody

  • chloride channel 5
  • Chloride channel protein 5
  • Chloride transporter ClC-5
  • CLC5
  • clC-5
  • H(+)/Cl(-) exchange transporter 5
  • hCIC-K2
  • hClC-K2
  • nephrolithiasis 1 (X-linked)
  • nephrolithiasis 2, X-linked
  • XLRH
  • XRN


Clcn5 is a proton-coupled chloride transporter. Clcn5 functions as antiport system and exchanges chloride ions against protons. Clcn5 is important for normal acidification of the endosome lumen.Clcn5 may play an important role in renal tubular function.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Mu, Rt
Applications: WB, IHC
Species: Hu
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB

Publications for CLCN5 Antibody (NBP1-69123) (0)

There are no publications for CLCN5 Antibody (NBP1-69123).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCN5 Antibody (NBP1-69123) (0)

There are no reviews for CLCN5 Antibody (NBP1-69123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLCN5 Antibody (NBP1-69123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CLCN5 Antibody (NBP1-69123)

Discover related pathways, diseases and genes to CLCN5 Antibody (NBP1-69123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLCN5 Antibody (NBP1-69123)

Discover more about diseases related to CLCN5 Antibody (NBP1-69123).

Pathways for CLCN5 Antibody (NBP1-69123)

View related products by pathway.

PTMs for CLCN5 Antibody (NBP1-69123)

Learn more about PTMs related to CLCN5 Antibody (NBP1-69123).

Blogs on CLCN5

There are no specific blogs for CLCN5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CLCN5 Antibody and receive a gift card or discount.


Gene Symbol CLCN5