SAV1 Antibody (3B2)

Images

 
Western Blot: SAV1 Antibody (3B2) [H00060485-M02] - MST2 and SAV1 increase the levels of PPAR-gamma by increasing its protein stability. Increasing amounts (0.5, 1, 3 ug) of Myc-SAV1 were co-expressed with Flag-PPAR ...read more
Immunocytochemistry/ Immunofluorescence: SAV1 Antibody (3B2) [H00060485-M02] - Analysis of monoclonal antibody to SAV1 on HeLa cell. Antibody concentration 60 ug/ml.
Western Blot: SAV1 Antibody (3B2) [H00060485-M02] - SAV1 monoclonal antibody (M02), clone 3B2. Analysis of SAV1 expression in HepG2.
Immunoprecipitation: SAV1 Antibody (3B2) [H00060485-M02] - Analysis of SAV1 transfected lysate using anti-SAV1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SAV1 MaxPab rabbit polyclonal ...read more
ELISA: SAV1 Antibody (3B2) [H00060485-M02] - Detection limit for recombinant GST tagged SAV1 is approximately 0.1ng/ml as a capture antibody.
MST2 and SAV1 increase the levels of PPARgamma by increasing its protein stability.(A) Increasing amounts (0.5, 1, 3 ug) of Myc-SAV1 were co-expressed with Flag-PPARgamma and/or HA-MST2 in 293 cells. At 48 h after ...read more

Product Details

Summary
Reactivity Hu, Mu, YeSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IP
Clone
3B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SAV1 Antibody (3B2) Summary

Immunogen
SAV1 (NP_068590, 300 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF
Specificity
SAV1 - salvador homolog 1 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SAV1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 26913567).
Publications
Read Publications using
H00060485-M02 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26913567).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SAV1 Antibody (3B2)

  • 45 kDa WW domain protein
  • hWW45
  • protein salvador homolog 1
  • salvador homolog 1 (Drosophila)
  • SAV
  • WW domain-containing
  • WW45salvador
  • WWP4,1700040G09Rik

Background

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a coiled-coil region. It is ubiquitously expressed in adult tissues. The encoded protein is 94% identical to the mouse protein at the amino acid level.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SAV1 Antibody (H00060485-M02)(9)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00060485-M02 Applications Species
Park SH, Park J, Lee Y, and Lee YH Mammalian Hippo kinase pathway is downregulated by BCL-2 via protein degradation. Biochem Biophys Res Commun. 2019-03-11 [PMID: 30867124]
Ji S, Liu Q, Zhang S et al. FGF15 Activates Hippo Signaling to Suppress Bile Acid Metabolism and Liver Tumorigenesis. Dev Cell. 2019-02-07 [PMID: 30745141]
Kai T, Tsukamoto Y, Hijiya N et al. Kidney-specific knockout of Sav1 in the mouse promotes hyper-proliferation of renal tubular epithelium through suppression of the Hippo pathway J. Pathol. 2016-02-24 [PMID: 26913567] (IHC-P, Mouse) IHC-P Mouse
Schutte U, Bisht S, Heukamp LC et al. Hippo signaling mediates proliferation, invasiveness and metastatic potential of clear cell renal cell carcinoma. Translational Oncology Volume 7. 2014-04-01 [PMID: 24913676]
Yin F, Yu J, Zheng Y et al. Spatial Organization of Hippo Signaling at the Plasma Membrane Mediated by the Tumor Suppressor Merlin/NF2. Cell. 2013-09-12 [PMID: 24012335] (WB, Human) WB Human
Li X, Luo X, Li Z et al. Screening of binding proteins that interact with human Salvador 1 in a human fetal liver cDNA library by the yeast two-hybrid system. Mol Biol Rep. 2012-05-09 [PMID: 22570112]
Park BH, Kim DS, Won GW et al. Mammalian Ste20-Like Kinase and SAV1 Promote 3T3-L1 Adipocyte Differentiation by Activation of PPARgamma. PLoS One. 2012-01-26 [PMID: 22292086]
Murakami H, Mizuno T, Taniguchi T et al. LATS2 Is a Tumor Suppressor Gene of Malignant Mesothelioma. Cancer Res. 2011-01-18 [PMID: 21245096]
Mardin BR, Lange C, Baxter JE et al. Components of the Hippo pathway cooperate with Nek2 kinase to regulate centrosome disjunction. Nat Cell Biol 12(12):1166-76. 2010-12-01 [PMID: 21076410]

Reviews for SAV1 Antibody (H00060485-M02) (0)

There are no reviews for SAV1 Antibody (H00060485-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SAV1 Antibody (H00060485-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAV1 Products

Research Areas for SAV1 Antibody (H00060485-M02)

Find related products by research area.

Blogs on SAV1

There are no specific blogs for SAV1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAV1 Antibody (3B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol SAV1
Entrez
OMIM
Uniprot