![Immunocytochemistry/Immunofluorescence: COL11A1 Antibody [NBP2-58159] - Staining of human cell line BJ shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/COL11A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58159-img0001.jpg "Immunocytochemistry/Immunofluorescence: COL11A1 Antibody [NBP2-58159] - Staining of human cell line BJ shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COL11A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC reported in scientific literature (PMID:31940494). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
-Immunocytochemistry-Immunofluorescence-NBP2-43728-img0003.jpg)
-Western-Blot-NBP2-43728-img0005.jpg)
-Western-Blot-NBP2-43728-img0002.jpg)
-ELISA-H00001290-M02-img0004.jpg)
-Immunocytochemistry-Immunofluorescence-H00001290-M02-img0002.jpg)
-Western-Blot-NBP1-05118-img0001.jpg)
-Western-Blot-NBP3-15419-img0001.jpg)
-Immunohistochemistry-Frozen-NB110-8146-img0003.jpg)
-Immunocytochemistry-Immunofluorescence-NB110-8146-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-NB110-8146-img0001.jpg)
| Publication using NBP2-58159 | Applications | Species |
|---|---|---|
| Maniati E, Berlato C, Gopinathan G et al. Mouse Ovarian Cancer Models Recapitulate the Human Tumor Microenvironment and Patient Response to Treatment Cell Rep 2020-01-14 [PMID: 31940494] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for COL11A1 Antibody (NBP2-58159)Discover more about diseases related to COL11A1 Antibody (NBP2-58159).
| Pathways for COL11A1 Antibody (NBP2-58159)View related products by pathway.
|
PTMs for COL11A1 Antibody (NBP2-58159)Learn more about PTMs related to COL11A1 Antibody (NBP2-58159).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COL11A1 |
-Immunohistochemistry-Paraffin-NB600-844-img0001.jpg)
-Immunohistochemistry-Paraffin-NB600-844-img0002.jpg)
-Western-Blot-NB600-844-img0003.jpg)
![COMP/Thrombospondin-5 [HRP]](https://images.novusbio.com/images2/COMP_DCMP0_ELISA_66.jpg)
![COMP/Thrombospondin-5 [HRP]](https://images.novusbio.com/images2/DATA_COMP_DCMP0_ELISA_632.jpg)
![MMP-13 [HRP]](https://images.novusbio.com/images2/MMP-13_DM1300_ELISA_136.jpg)
![MMP-13 [HRP]](https://images.novusbio.com/images2/DATA_MMP13_DM1300_ELISA_751.jpg)
![MMP-9 [HRP]](https://images.novusbio.com/images2/MMP-9_DMP900_ELISA_148.jpg)
![MMP-9 [HRP]](https://images.novusbio.com/images2/DATA_MMP9_DMP900_ELISA_770.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")