COL11A1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COL11A1 Antibody [NBP2-58159] - Staining of human cell line BJ shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COL11A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL11A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC reported in scientific literature (PMID:31940494).
Control Peptide
COL11A1 Recombinant Protein Antigen (NBP2-58159PEP)
Publications
Read Publication using
NBP2-58159 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Rat 86%. Use in Mouse reported in scientific literature (PMID:31940494).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for COL11A1 Antibody

  • alpha-1 polypeptide
  • COLL6
  • collagen, type XI, alpha 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-99960
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NB600-408
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, Flow, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PAGE, WB
NBP2-30450
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB600-594
Species: Bv, Fe, Hu, Mu, Rt, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
DCMP0
Species: Hu
Applications: ELISA
H00001299-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
H00001290-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-05118
Species: Bv, Ca, Ch(-), Gp(-), Hu, Ma, Mu(-), Po, Rb, Rt(-), Sh
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
DM1300
Species: Hu
Applications: ELISA
NBP3-15419
Species: Mu, Rt
Applications: WB
NB110-8146
Species: Bv, Fe, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IM, WB
NBP2-92790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP3-15841
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DMP900
Species: Hu
Applications: ELISA

Publications for COL11A1 Antibody (NBP2-58159)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for COL11A1 Antibody (NBP2-58159) (0)

There are no reviews for COL11A1 Antibody (NBP2-58159). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COL11A1 Antibody (NBP2-58159) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COL11A1 Products

Bioinformatics Tool for COL11A1 Antibody (NBP2-58159)

Discover related pathways, diseases and genes to COL11A1 Antibody (NBP2-58159). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL11A1 Antibody (NBP2-58159)

Discover more about diseases related to COL11A1 Antibody (NBP2-58159).
 

Pathways for COL11A1 Antibody (NBP2-58159)

View related products by pathway.

PTMs for COL11A1 Antibody (NBP2-58159)

Learn more about PTMs related to COL11A1 Antibody (NBP2-58159).

Blogs on COL11A1

There are no specific blogs for COL11A1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COL11A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL11A1