Flt-3/Flk-2/CD135 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FLT3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Flt-3/Flk-2/CD135 Antibody - BSA Free
Background
Stem cell tyrosine kinase (STK-1) has been cloned from a CD34+ hematopoietic stem cell enriched library and identified as the human homolog of a previously identified gene of mouse origin designated either Flk-2 or Flt-3. The STK-1 cDNA encodes a protein of 993 amino acids with 85% identity to Flt-3/Flk-2. STK-1 is a member of the type III receptor tyrosine kinase family that includes Kit (steel factor receptor), Fms and PDGF. STK-1 expression in blood and marrow is restricted to CD34+ cells, a population greatly enriched for hematopoietic stem/progenitor cells. STK-1 antiserum recognizes two polypeptides in these cells. The mouse homolog of STK-1, designated Flt-3/ Flk-2, is expressed at high levels in hematopoietic cells and also in neural, gonadal, hepatic and placental tissues. It has been suggested that STK-1 and its murine homolog Flt-3/ Flk-2 may function as growth factor receptors on hematopoietic stem and/or progenitor cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, Neut, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Publications for Flt-3/Flk-2/CD135 Antibody (NBP2-57187) (0)
There are no publications for Flt-3/Flk-2/CD135 Antibody (NBP2-57187).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Flt-3/Flk-2/CD135 Antibody (NBP2-57187) (0)
There are no reviews for Flt-3/Flk-2/CD135 Antibody (NBP2-57187).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Flt-3/Flk-2/CD135 Antibody (NBP2-57187) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Flt-3/Flk-2/CD135 Products
Research Areas for Flt-3/Flk-2/CD135 Antibody (NBP2-57187)
Find related products by research area.
|
Blogs on Flt-3/Flk-2/CD135