FLIP Antibody

Images

 
Western Blot: FLIP Antibody [NBP1-85675] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: FLIP Antibody [NBP1-85675] - Staining of human cell line A-431 shows localization to nucleus, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: FLIP Antibody [NBP1-85675] - Staining of human small intestine shows distinct positivity of the brush border in glandular cells.
Immunocytochemistry/ Immunofluorescence: FLIP Antibody [NBP1-85675] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FLIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFLAR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FLIP Protein (NBP1-85675PEP)
Publications
Read Publication using NBP1-85675.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23059775)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FLIP Antibody

  • CASHFADD-like antiapoptotic molecule 1
  • CASP8 and FADD-like apoptosis regulator
  • CASP8AP1
  • Caspase homolog
  • Caspase-eight-related protein
  • Caspase-like apoptosis regulatory protein
  • caspase-related inducer of apoptosis
  • CASPER
  • CasperFLAME1
  • Cellular FLICE-like inhibitory protein
  • CFLAR
  • c-FLIPR
  • c-FLIPS
  • CLARPMACH-related inducer of toxicity
  • FADD-like apoptotic molecule
  • FLAME
  • FLAME-1
  • FLIP
  • I-FLICE
  • I-FLICEMRITc-FLIPFLIPc-FLIPL
  • Inhibitor of FLICE
  • usurpin beta
  • Usurpin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
126-FL/CF
Species: Hu
AF347
Species: Hu
Applications: WB, IHC, Neut
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for FLIP Antibody (NBP1-85675)(1)

Reviews for FLIP Antibody (NBP1-85675) (0)

There are no reviews for FLIP Antibody (NBP1-85675). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FLIP Antibody (NBP1-85675) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLIP Products

Bioinformatics Tool for FLIP Antibody (NBP1-85675)

Discover related pathways, diseases and genes to FLIP Antibody (NBP1-85675). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLIP Antibody (NBP1-85675)

Discover more about diseases related to FLIP Antibody (NBP1-85675).
 

Pathways for FLIP Antibody (NBP1-85675)

View related products by pathway.

PTMs for FLIP Antibody (NBP1-85675)

Learn more about PTMs related to FLIP Antibody (NBP1-85675).
 

Research Areas for FLIP Antibody (NBP1-85675)

Find related products by research area.

Blogs on FLIP.

TRAIL-R2: The Trail Less Traveled
Cells undergo apoptotic programmed cell death in response to various stimuli, and this key mechanism is necessary for cellular morphogenesis, tissue homeostasis, and host defense. Particular cytokines such as tumor necrosis factor (TNF) and the Fas li...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CFLAR
Entrez