FLAP Antibody - BSA Free

Immunohistochemistry-Paraffin: FLAP Antibody [NBP1-84666] - Staining in human bone marrow and skeletal muscle tissues using anti-ALOX5AP antibody. Corresponding ALOX5AP RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FLAP Antibody [NBP1-84666] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: FLAP Antibody [NBP1-84666] - Staining of human bone marrow shows cytoplasmic and nuclear membrane positivity in hematopoietic cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FLAP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVL
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALOX5AP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 18 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  FLAP Protein (NBP1-84666PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FLAP Antibody - BSA Free

• arachidonate 5-lipoxygenase-activating protein
• FLAPMK-886-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FLAP Antibody (NBP1-84666)(3)

Publications using NBP1-84666

• Brunner SM, Schrödl F, Preishuber-Pflügl J et al. Distribution of the cysteinyl leukotriene system components in the human, rat and mouse eye Experimental eye research 2023-05-19 [PMID: 37211287] (IHC-P, Human)
• Perisic L, Hedin E, Razuvaev A et al. Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis. Arterioscler Thromb Vasc Biol 2013-10-01 [PMID: 23908247]

Bioinformatics

• Gene Symbol: ALOX5AP
• Entrez:
  • 241(Human)
• Uniprot:
  • P20292(Human)