COX-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining in human skin and skeletal muscle tissues using anti-PTGS1 antibody. Corresponding PTGS1 RNA-seq data are presented for the same tissues.

Western Blot: COX-1 Antibody [NBP1-85500] - Analysis in human cell line HELA.

COX-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85500-img0014.jpg

Immunocytochemistry/Immunofluorescence: COX-1 Antibody [NBP1-85500] - Staining of human cell line BJ shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skin shows high expression.

Simple Western: COX-1 Antibody [NBP1-85500] - Lane view shows one specific signal (~70kDa) in lysates prepared from the mouse tail vein. Image from a verified customer review.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COX-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit COX-1 Antibody - BSA Free (NBP1-85500) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-COX-1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGN
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTGS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. COX-1 antibody validated for Simple Western from a verified customer review.
  See Simple Western Antibody Database for Simple Western validation: Tested in Mouse tail vein lysates, separated by Size, apparent MW was 70 kDa
• Control Peptide:

  COX-1 Protein (NBP1-85500PEP)

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for COX-1 Antibody - BSA Free

• COX1
• COX-1
• COX1PGG/HS
• COX3
• cyclooxygenase-1
• EC 1.14.99.1
• PCOX1
• PGH synthase 1
• PGHS1
• PGHS-1PHS1
• PHS 1
• prostaglandin G/H synthase 1
• prostaglandin G/H synthase and cyclooxygenase
• Prostaglandin H2 synthase 1
• prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase andcyclooxygenase)
• Prostaglandin-endoperoxide synthase 1
• PTGHS
• PTGS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COX-1 Antibody (NBP1-85500)(3)

Publications using NBP1-85500

• Liu C, Tate T, Batourina E et al. Pparg promotes differentiation and regulates mitochondrial gene expression in bladder epithelial cells Nat Commun 2019-10-09 [PMID: 31597917] (IHC-P, Mouse)
• Uram L, Filipowicz A, Misiorek M et al. Biotinylated PAMAM G3 dendrimer conjugated with celecoxib and/or Fmoc-l-Leucine and its cytotoxicity for normal and cancer human cell lines Eur J Pharm Sci 2018-08-15 [PMID: 30118847] (WB, Human)
• Asplund A, Gry Bjorklund M, Sundquist C et al. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. Br J Dermatol 2008-03-01 [PMID: 18241271]

Review for COX-1 Antibody (NBP1-85500) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer Simple Western Mouse 11/02/2017

Summary

• Application: Simple Western
• Sample Tested: tail vein lysates
• Species: Mouse
• Lot: YEX617011

Comments

• Comments: This run was performed under reducing conditions using the 12-230 kDa separation system in combination with a rabbit detection system. Lysis buffer: RIPA, prot. conc.: 0.7 µg/µl.

FAQs for COX-1 Antibody (NBP1-85500). (Showing 1 - 1 of 1 FAQs).

1. Please could you tell me if Novus Biologicals has an active COX1 Recombinant Protein?
   • Unfortunately we do not currently have any COX1 recombinant proteins that are expected to be active.

Bioinformatics

• Gene Symbol: PTGS1