COX-1 Antibody

Images

 
Western Blot: COX-1 Antibody [NBP1-85500] - Analysis in human cell line HELA.
Immunocytochemistry/ Immunofluorescence: COX-1 Antibody [NBP1-85500] - Immunofluorescent staining of human cell line BJ shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining in human skin and skeletal muscle tissues using anti-PTGS1 antibody. Corresponding PTGS1 RNA-seq data are presented for ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

COX-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGN
Specificity
Specificity of human COX-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COX-1 Protein (NBP1-85500PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85500 in the following applications:

Publications
Read Publication using NBP1-85500.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COX-1 Antibody

  • COX1
  • COX-1
  • COX1PGG/HS
  • COX3
  • cyclooxygenase-1
  • EC 1.14.99.1
  • PCOX1
  • PGH synthase 1
  • PGHS1
  • PGHS-1PHS1
  • PHS 1
  • prostaglandin G/H synthase 1
  • prostaglandin G/H synthase and cyclooxygenase
  • Prostaglandin H2 synthase 1
  • prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase andcyclooxygenase)
  • Prostaglandin-endoperoxide synthase 1
  • PTGHS
  • PTGS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65875
Species: Hu
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for COX-1 Antibody (NBP1-85500)(1)

Review for COX-1 Antibody (NBP1-85500) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-85500:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western COX-1 NBP1-85500
Enlarge
reviewed by:
Anonymous
Simple Western Mouse 11/02/2017
View

Summary

ApplicationSimple Western
Sample Testedtail vein lysates
SpeciesMouse
LotYEX617011

Comments

CommentsThis run was performed under reducing conditions using the 12-230 kDa separation system in combination with a rabbit detection system. Lysis buffer: RIPA, prot. conc.: 0.7 µg/µl.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COX-1 Antibody (NBP1-85500). (Showing 1 - 1 of 1 FAQ).

  1. Please could you tell me if Novus Biologicals has an active COX1 Recombinant Protein?
    • Unfortunately we do not currently have any COX1 recombinant proteins that are expected to be active.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for COX-1 Antibody (NBP1-85500)

Discover related pathways, diseases and genes to COX-1 Antibody (NBP1-85500). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX-1 Antibody (NBP1-85500)

Discover more about diseases related to COX-1 Antibody (NBP1-85500).
 

Pathways for COX-1 Antibody (NBP1-85500)

View related products by pathway.

PTMs for COX-1 Antibody (NBP1-85500)

Learn more about PTMs related to COX-1 Antibody (NBP1-85500).
 

Research Areas for COX-1 Antibody (NBP1-85500)

Find related products by research area.

Blogs on COX-1

There are no specific blogs for COX-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
11/02/2017
Application: Simple Western
Species: Mouse

Bioinformatics

Gene Symbol PTGS1
Entrez