COX-1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining in human skin and skeletal muscle tissues using anti-PTGS1 antibody. Corresponding PTGS1 RNA-seq data are presented for ...read more
Western Blot: COX-1 Antibody [NBP1-85500] - Analysis in human cell line HELA.
Immunocytochemistry/ Immunofluorescence: COX-1 Antibody [NBP1-85500] - Validation of gene expression changes from RNA-Seq experiments. b, d Cox1 and Krt5 expression in a control (b) and in the ShhCre;Ppargfl/fl mutant ...read more
Immunocytochemistry/ Immunofluorescence: COX-1 Antibody [NBP1-85500] - Staining of human cell line BJ shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skin shows high expression.
Simple Western: COX-1 Antibody [NBP1-85500] - Lane view shows one specific signal (~70kDa) in lysates prepared from the mouse tail vein. Image from a verified customer review.
FASN Regulates HIF-alpha Protein Stability and HIF Target Gene Expression. (A) FASN siRNA downregulates HIF-alpha protein levels. PREC, HeLa and HCT116 cells were treated with FASN (+) or control (−) siRNA and ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

COX-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGN
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. COX-1 antibody validated for Simple Western from a verified customer review.
Control Peptide
COX-1 Protein (NBP1-85500PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85500 in the following applications:

Publications
Read Publications using
NBP1-85500 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COX-1 Antibody

  • COX1
  • COX-1
  • COX1PGG/HS
  • COX3
  • cyclooxygenase-1
  • EC 1.14.99.1
  • PCOX1
  • PGH synthase 1
  • PGHS1
  • PGHS-1PHS1
  • PHS 1
  • prostaglandin G/H synthase 1
  • prostaglandin G/H synthase and cyclooxygenase
  • Prostaglandin H2 synthase 1
  • prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase andcyclooxygenase)
  • Prostaglandin-endoperoxide synthase 1
  • PTGHS
  • PTGS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COX-1 Antibody (NBP1-85500)(3)

Review for COX-1 Antibody (NBP1-85500) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-85500:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western COX-1 NBP1-85500
Enlarge
5
reviewed by:
Verified Customer
Simple Western Mouse 11/02/2017
View

Summary

ApplicationSimple Western
Sample Testedtail vein lysates
SpeciesMouse
LotYEX617011

Comments

CommentsThis run was performed under reducing conditions using the 12-230 kDa separation system in combination with a rabbit detection system. Lysis buffer: RIPA, prot. conc.: 0.7 µg/µl.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COX-1 Antibody (NBP1-85500). (Showing 1 - 1 of 1 FAQs).

  1. Please could you tell me if Novus Biologicals has an active COX1 Recombinant Protein?
    • Unfortunately we do not currently have any COX1 recombinant proteins that are expected to be active.

Secondary Antibodies

 

Isotype Controls

Additional COX-1 Products

Research Areas for COX-1 Antibody (NBP1-85500)

Find related products by research area.

Blogs on COX-1

There are no specific blogs for COX-1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
11/02/2017
Application: Simple Western
Species: Mouse

Bioinformatics

Gene Symbol PTGS1