LTC4S Antibody

Images

 
Western Blot: LTC4S Antibody [NBP1-69315] - This Anti-LTC4S antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.
Western Blot: LTC4S Antibody [NBP1-69315] - Antibody Titration: 1 ug/ml Positive control: HepG2.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LTC4S Antibody Summary

Immunogen
Synthetic peptides corresponding to LTC4S(leukotriene C4 synthase) The peptide sequence was selected from the N terminal of LTC4S. Peptide sequence MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LTC4S
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LTC4S and was validated on Western blot.
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LTC4S Antibody

  • EC 4.4.1.20
  • leukotriene C4 synthase
  • Leukotriene-C(4) synthase
  • LTC4 synthase
  • MGC33147

Background

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47829
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB300-891
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NLS1317
Species: Hu, Mk, Pm
Applications: Flow, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-82653
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
H00004259-D01P
Species: Hu
Applications: WB

Publications for LTC4S Antibody (NBP1-69315) (0)

There are no publications for LTC4S Antibody (NBP1-69315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LTC4S Antibody (NBP1-69315) (0)

There are no reviews for LTC4S Antibody (NBP1-69315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LTC4S Antibody (NBP1-69315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LTC4S Products

Bioinformatics Tool for LTC4S Antibody (NBP1-69315)

Discover related pathways, diseases and genes to LTC4S Antibody (NBP1-69315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LTC4S Antibody (NBP1-69315)

Discover more about diseases related to LTC4S Antibody (NBP1-69315).
 

Pathways for LTC4S Antibody (NBP1-69315)

View related products by pathway.

PTMs for LTC4S Antibody (NBP1-69315)

Learn more about PTMs related to LTC4S Antibody (NBP1-69315).

Blogs on LTC4S

There are no specific blogs for LTC4S, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LTC4S Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LTC4S
Uniprot