FIZ1 Antibody - BSA Free

Western Blot: FIZ1 Antibody [NBP2-82794] - WB Suggested Anti-FIZ1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Small Intestine

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FIZ1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FIZ1 Antibody - BSA Free (NBP2-82794) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FIZ1. Peptide sequence: LAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGPGAPPAQAWA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FIZ1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FIZ1 Antibody - BSA Free

• FLJ00416
• FLT3-interacting zinc finger 1
• flt3-interacting zinc finger protein 1
• Zinc finger protein 798
• ZNF798FLJ14768

Background

The FIZ1 gene encodes zinc finger protein, which interacts with a receptor tyrosine kinase involved in the regulation ofhematopoietic and lymphoid cells. This gene product also interacts with a transcription factor that regulates theexpression of rod-specific

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FIZ1