ARF4L Antibody - Azide and BSA Free

Western Blot: ARF4L Antibody [NBP2-92876] - Analysis of extracts of various cell lines, using ARF4L at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.

Immunohistochemistry-Paraffin: ARF4L Antibody [NBP2-92876] - Paraffin-embedded rat brain using ARF4L .

Immunohistochemistry-Paraffin: ARF4L Antibody [NBP2-92876] - Paraffin-embedded human placenta using ARF4L .

Immunohistochemistry-Paraffin: ARF4L Antibody [NBP2-92876] - Paraffin-embedded mouse testis using ARF4L .

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ARF4L Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ARF4L Antibody - Azide and BSA Free (NBP2-92876) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 92-201 of human ARL4D (NP_001652.2). RRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARL4D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ARF4L Antibody - Azide and BSA Free

• ADP-ribosylation factor 4-like
• ADP-ribosylation factor-like 4D
• ADP-ribosylation factor-like protein 4D
• ADP-ribosylation factor-like protein 4L
• ARF4LADP-ribosylation factor-like 6
• ARL6

Background

ARF4L is a member of the ARF family which plays roles in vesicular traffic and actin remodeling. This protein plays a role in protein secretion and intracellular trafficking.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ARL4D