![Western Blot: LPCAT1 Antibody [NBP1-88923] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPCAT1 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/fullsize2/LPCAT1-Antibody-Western-Blot-NBP1-88923-img0008.jpg "Western Blot: LPCAT1 Antibody [NBP1-88923] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPCAT1 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSV |
| Specificity | Specificity of human LPCAT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LPCAT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF reported in scientific literature (PMID: 24557352). For IHC-Paraffin, HIER pH 6 retrieval is recommended. LPCAT1 antibody validated for ICC/IF from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Martin Helley |
IHC | Rat | 02/12/2013 |
Summary
Blocking
Primary Anitbody
Secondary Antibody
Details
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for LPCAT1 Antibody (NBP1-88923)Discover more about diseases related to LPCAT1 Antibody (NBP1-88923).
| Pathways for LPCAT1 Antibody (NBP1-88923)View related products by pathway.
|
PTMs for LPCAT1 Antibody (NBP1-88923)Learn more about PTMs related to LPCAT1 Antibody (NBP1-88923).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LPCAT1 |
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.](http://images.novusbio.com/fullsize2/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0013.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.")
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex, kidney, liver and lung using Anti-LPCAT1 antibody NBP1-88923 (A) shows similar protein distribution across tissues to independent antibody NBP1-88922 (B).](http://images.novusbio.com/fullsize2/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0009.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex, kidney, liver and lung using Anti-LPCAT1 antibody NBP1-88923 (A) shows similar protein distribution across tissues to independent antibody NBP1-88922 (B).")
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Analysis in human lung and liver tissues. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0010.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Analysis in human lung and liver tissues. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0011.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0012.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize2/LPCAT1 Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0014.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Western Blot: Phospholipase B1 Antibody [H00151056-B01P] - Analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/Phospholipase B1 Antibody-Western Blot-H00151056-B01P-img0001.jpg)
![Western Blot: AGPAT1 Antibody [NBP2-57898] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/images2/AGPAT1 Antibody-Western Blot-NBP2-57898-img0002.jpg)
![Immunohistochemistry-Paraffin: AGPAT1 Antibody [NBP2-57898] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and glial cells.](http://images.novusbio.com/images2/AGPAT1-Antibody-Immunohistochemistry-Paraffin-NBP2-57898-img0001.jpg)
![Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining in human adrenal gland and liver tissues using anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Immunohistochemistry-Paraffin-NBP1-81838-img0010.jpg)
![Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Western-Blot-NBP1-81838-img0011.jpg)
![Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Western-Blot-NBP1-81838-img0006.jpg)
![Western Blot: PLA2G4A Antibody [NBP1-31344] - Sample (30 ug of whole cell lysate) A: Raji 7.5% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/images2/PLA2G4A-Antibody-Western-Blot-NBP1-31344-img0011.jpg)
![Immunocytochemistry/Immunofluorescence: PLA2G4A Antibody [NBP1-31344] - Analysis of HeLa, using NBP1-31344 at 1:200 dilution.](http://images.novusbio.com/images2/PLA2G4A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31344-img0008.jpg)
![Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP1-31344] - PLA2G4A antibody detects PLA2G4A protein at cytoplasm in mouse liver by immunohistochemical analysis. Sample: Paraffin-embedded mouse liver. PLA2G4A antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min](http://images.novusbio.com/images2/PLA2G4A-Antibody-Immunohistochemistry-Paraffin-NBP1-31344-img0013.jpg)
![Western Blot: LPCAT3 Antibody [NBP3-04752] - Analysis of extracts of various cell lines, using LPCAT3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basi](http://images.novusbio.com/images2/LPCAT3 Antibody-Western Blot-NBP3-04752-img0001.jpg)
![Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/images2/LPCAT2-Antibody-Western-Blot-NBP1-88921-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.](http://images.novusbio.com/images2/LPCAT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88921-img0011.jpg)
![Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining in human thyroid gland and skeletal muscle tissues using anti-LPCAT2 antibody. Corresponding LPCAT2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/LPCAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88921-img0017.jpg)
![Western Blot: MBOAT2 Antibody [NBP1-82236] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/images2/MBOAT2-Antibody-Western-Blot-NBP1-82236-img0006.jpg)
![Immunohistochemistry-Paraffin: MBOAT2 Antibody [NBP1-82236] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/MBOAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-82236-img0001.jpg)
![Western Blot: ORC3L Antibody [NB100-796] - Staining of HeLa lysate (RIPA buffer, 1.4E5 cells per lane). Antibody at 2 ug/mL. Detected by chemiluminescence.](http://images.novusbio.com/images2/ORC3L Antibody-Western Blot-NB100-796-img0002.jpg)
![Immunohistochemistry-Paraffin: ORC3L Antibody [NB100-796] - Staining of paraffin embedded Human Cortex. Antibody at 3.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/ORC3L-Antibody-Immunohistochemistry-Paraffin-NB100-796-img0003.jpg)
![Western Blot: SPNS1 Antibody [NBP1-92440] - Analysis in human cell line HEK 293.](http://images.novusbio.com/images2/SPNS1-Antibody-Western-Blot-NBP1-92440-img0014.jpg)
![Immunohistochemistry-Paraffin: SPNS1 Antibody [NBP1-92440] - Staining in human lung and pancreas tissues using NBP1-92440 antibody. Corresponding SPNS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/SPNS1-Antibody-Immunohistochemistry-Paraffin-NBP1-92440-img0020.jpg)
![Immunohistochemistry-Paraffin: SPNS1 Antibody [NBP1-92440] - Staining of human lung shows strong granular cytoplasmic positivity in macrophages.](http://images.novusbio.com/images2/SPNS1-Antibody-Immunohistochemistry-Paraffin-NBP1-92440-img0015.jpg)
![Western Blot: LAT Antibody (LAT.10-17) [NBP2-00289] - 10e6 normal peripheral human blood cells (lane 1), Jurkat (lane 2), and C57BL/6 splenocytes (lane 3) with 5 ug/mL Anti-Human LAT Purified. Bands were visualized using Anti-Mouse IgG HRP.](http://images.novusbio.com/images2/LAT-Antibody-(LAT.10-17)-Western-Blot-NBP2-00289-img0001.jpg)
![Immunohistochemistry-Paraffin: LAT Antibody (LAT.10-17) [NBP2-00289] - Staining of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 20 ug/ml.](http://images.novusbio.com/images2/LAT-Antibody-(LAT.10-17)-Immunohistochemistry-Paraffin-NBP2-00289-img0006.jpg)
![Flow (Cell Surface): LAT Antibody (LAT.10-17) [NBP2-00289] - Analysis using the Allophycocyanin conjugate of NBP2-00289. Surface staining of normal human peripheral blood cells with Anti-Human CD3 FITC followed by intracellular staining with Mouse IgG1 kappa Isotype Control APC (left) or Anti-Human LAT APC (right).](http://images.novusbio.com/images2/LAT-Antibody-(LAT.10-17)-Flow-(Cell-Surface)-NBP2-00289-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free [NBP2-73621] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY PCSK7.](http://images.novusbio.com/images2/Proprotein-Convertase-7-PCSK7-Antibody-(OTI1B8)---Azide-and-BSA-Free-Immunocytochemistry-Immunofluorescence-NBP2-73621-img0003.jpg)
![Flow Cytometry: Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free [NBP2-73621] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-PCSK7 antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/images2/Proprotein-Convertase-7-PCSK7-Antibody-(OTI1B8)---Azide-and-BSA-Free-Flow-Cytometry-NBP2-73621-img0002.jpg)
![Flow Cytometry: Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free [NBP2-73621] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-PCSK7 antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/images2/Proprotein-Convertase-7-PCSK7-Antibody-(OTI1B8)---Azide-and-BSA-Free-Flow-Cytometry-NBP2-73621-img0001.jpg)
![Western Blot: LCAT Antibody [NBP1-05950] - Analysis of plasma LCAT protein mass. Plasma samples (0.2ul) from four hA-I Tg mice, four hA-I Tg SR-BI -/- mice, a LCAT-/- mouse, and purified mouse LCAT were fractionated on SDS-PAGE, and LCAT was detected by Western blot analysis using rabbit antiserum against mouse LCAT.](http://images.novusbio.com/images2/LCAT Antibody-Western Blot-NBP1-05950-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: LCAT Antibody [NBP1-05950] - The LCAT antibody was tested at a 1:500 dilution in HeLa cells against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue).](http://images.novusbio.com/images2/LCAT-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-05950-img0004.jpg)
![Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.](http://images.novusbio.com/images2/Albumin-Antibody-Western-Blot-NB600-41532-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Albumin-Antibody-Immunocytochemistry-Immunofluorescence-NB600-41532-img0003.jpg)
![Western Blot: ACOT8 Antibody [NBP1-32452] - Rat tissue extracts (50 ug) was separated by 10 % SDS-PAGE, and the membrane was blotted with ACOT8 antibody diluted by 1:1000.](http://images.novusbio.com/images2/ACOT8-Antibody-Western-Blot-NBP1-32452-img0005.jpg)
![Western Blot: ACOT8 Antibody [NBP1-32452] - Sample(30 ug whole cell lysate)A:MOLT4 B:Raji 10% SDS PAGE, antibody diluted at 1:1000.](http://images.novusbio.com/images2/ACOT8 Antibody-Western Blot-NBP1-32452-img0002.jpg)
![Western Blot: ACOT8 Antibody [NBP1-32452] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with ACOT8 antibody diluted by 1:1000.](http://images.novusbio.com/images2/ACOT8-Antibody-Western-Blot-NBP1-32452-img0003.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")