LPCAT1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Analysis in human lung and liver tissues. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex, kidney, liver and lung using Anti-LPCAT1 antibody NBP1-88923 (A) shows similar protein ...read more
Orthogonal Strategies: Western Blot: LPCAT1 Antibody [NBP1-88923] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPCAT1 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LPCAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPCAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF reported in scientific literature (PMID: 24557352). For IHC-Paraffin, HIER pH 6 retrieval is recommended. LPCAT1 antibody validated for IHC from a verified customer review.
Control Peptide
LPCAT1 Protein (NBP1-88923PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-88923 in the following applications:

Publications
Read Publications using
NBP1-88923 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24557352). Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LPCAT1 Antibody

  • 1-acylglycerophosphocholine O-acyltransferase
  • Acetyl-CoA:lyso-PAF acetyltransferase
  • Acetyl-CoA:lyso-platelet-activating factor acetyltransferase
  • acyl-CoA:lysophosphatidylcholine acyltransferase 1
  • acyltransferase like 2
  • Acyltransferase-like 2
  • AYTL2
  • EC 2.3.1.-
  • EC 2.3.1.23,1-alkylglycerophosphocholine O-acetyltransferase
  • EC 2.3.1.67
  • FLJ12443
  • FLJ41609
  • LPC acyltransferase 1
  • lpcat
  • LPCAT-1
  • Lyso-PAF acetyltransferase
  • lysoPAFAT
  • LysoPC acyltransferase 1
  • lysophosphatidylcholine acyltransferase 1
  • PFAAP3
  • Phosphonoformate immuno-associated protein 3
  • regulated by phosphonoformate

Background

Lysophosphatidylcholine (LPC) acyltransferase (LPCAT; EC 2.3.1.23) catalyzes the conversion of LPC tophosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis (Nakanishi et al., 2006 (PubMed16704971)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00151056-B01P
Species: Hu, Mu
Applications: WB
MAB5018
Species: Hu
Applications: IP, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-57898
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04752
Species: Hu, Mu, Rt
Applications: WB
NBP1-88921
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82236
Species: Hu
Applications: IHC, IHC-P, KD, WB
NB100-796
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-92440
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-27104
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
NBP2-73621
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF
NBP1-05950
Species: Hu, Mu
Applications: ICC/IF, WB
H00154141-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DPLG70
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
NBP1-88923
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LPCAT1 Antibody (NBP1-88923)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for LPCAT1 Antibody (NBP1-88923) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-88923:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry LPCAT1 NBP1-88923
Enlarge
3
reviewed by:
Verified Customer
IHC Rat 02/12/2013
View

Summary

ApplicationImmunohistochemistry
Sample Testedfrozen (8um sections) DRG Rat tissue
SpeciesRat

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LPCAT1 Antibody (NBP1-88923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LPCAT1 Products

Bioinformatics Tool for LPCAT1 Antibody (NBP1-88923)

Discover related pathways, diseases and genes to LPCAT1 Antibody (NBP1-88923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LPCAT1 Antibody (NBP1-88923)

Discover more about diseases related to LPCAT1 Antibody (NBP1-88923).
 

Pathways for LPCAT1 Antibody (NBP1-88923)

View related products by pathway.

PTMs for LPCAT1 Antibody (NBP1-88923)

Learn more about PTMs related to LPCAT1 Antibody (NBP1-88923).

Blogs on LPCAT1

There are no specific blogs for LPCAT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Verified Customer
02/12/2013
Application: IHC
Species: Rat

Bioinformatics

Gene Symbol LPCAT1