Home » LPCAT1 » LPCAT1 Antibodies » LPCAT1 Antibody

LPCAT1 Antibody

 (2 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Analysis in human lung and liver tissues. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Analysis in human lung and liver tissues. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex, kidney, liver and lung using Anti-LPCAT1 antibody NBP1-88923 (A) shows similar protein ...read more
Orthogonal Strategies: Western Blot: LPCAT1 Antibody [NBP1-88923] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPCAT1 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

LPCAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPCAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF reported in scientific literature (PMID: 24557352). For IHC-Paraffin, HIER pH 6 retrieval is recommended. LPCAT1 antibody validated for IHC from a verified customer review.
Control Peptide
LPCAT1 Protein (NBP1-88923PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-88923 in the following applications:
Publications
Read Publications using
NBP1-88923 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24557352). Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LPCAT1 Antibody

  • 1-acylglycerophosphocholine O-acyltransferase
  • Acetyl-CoA:lyso-PAF acetyltransferase
  • Acetyl-CoA:lyso-platelet-activating factor acetyltransferase
  • acyl-CoA:lysophosphatidylcholine acyltransferase 1
  • acyltransferase like 2
  • Acyltransferase-like 2
  • AYTL2
  • EC 2.3.1.-
  • EC 2.3.1.23,1-alkylglycerophosphocholine O-acetyltransferase
  • EC 2.3.1.67
  • FLJ12443
  • FLJ41609
  • LPC acyltransferase 1
  • lpcat
  • LPCAT-1
  • Lyso-PAF acetyltransferase
  • lysoPAFAT
  • LysoPC acyltransferase 1
  • lysophosphatidylcholine acyltransferase 1
  • PFAAP3
  • Phosphonoformate immuno-associated protein 3
  • regulated by phosphonoformate

Background

Lysophosphatidylcholine (LPC) acyltransferase (LPCAT; EC 2.3.1.23) catalyzes the conversion of LPC tophosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis (Nakanishi et al., 2006 (PubMed16704971)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Phospholipase B1
Antibody
H00151056-B01P
Western Blot: Phospholipase B1 Antibody [H00151056-B01P] - Analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu, Mu
Applications: WB
PLA2G1B Antibody
(630823)
MAB5018
Western blot shows lysates of human pancreas tissue. PVDF Membrane was probed with 2 µg/mL of Human PLA2G1B Monoclonal Antibody (Catalog # MAB5018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for PLA2G1B at approximately 17 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IP, WB
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Simple Western lane view shows lysates of SH‑SY5Y human neuroblastoma cell line, loaded at 0.5 mg/mL. A specific band was detected for 14‑3‑3 zeta at approximately 34 kDa (as indicated) using 2 µg/mL of Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line,SK‑Mel‑28 human malignant melanoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and C6 rat glioma cell line. PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Human14‑3‑3 zeta  Monoclonal Antibody (Catalog # MAB2669) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for14‑3‑3 zeta at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
14‑3‑3 zeta  was detected in immersion fixed paraffin-embedded sections of human squamous cell carcinoma using Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei and plasma membrane. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
Species: Hu
Applications: IHC, Simple Western, WB
AGPAT1 Antibody
NBP2-57898
Western Blot: AGPAT1 Antibody [NBP2-57898] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: AGPAT1 Antibody [NBP2-57898] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and glial cells.
Species: Hu
Applications: IHC, IHC-P, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
PLA2G4A Antibody
NBP1-31344
Immunocytochemistry/Immunofluorescence: PLA2G4A Antibody [NBP1-31344] - Analysis of HeLa, using NBP1-31344 at 1:200 dilution.
Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP1-31344] - U87 xenograft, using PLA2G4A antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: PLA2G4A Antibody [NBP1-31344] - Sample (30 ug of whole cell lysate) A: NIH-3T3 7.5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
LPCAT3 Antibody
NBP3-04752
Western Blot: LPCAT3 Antibody [NBP3-04752] - Analysis of extracts of various cell lines, using LPCAT3 antibody (NBP3-04752) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
LPCAT2 Antibody
NBP1-88921
Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of murine cell line RAW264.7. Image provided by product review by verified customer.
Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human skeletal muscle shows very weak positivity in myocytes.
Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human small intestine shows weak membranous positivity in glandular cells.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MBOAT2 Antibody
NBP1-82236
Western Blot: MBOAT2 Antibody [NBP1-82236] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: MBOAT2 Antibody [NBP1-82236] - Staining of human Cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: MBOAT2 Antibody [NBP1-82236] - Staining of human Lymph node shows strong granular cytoplasmic positivity in non-germinal center cells.
Species: Hu
Applications: IHC, IHC-P, KD, WB
ORC3L Antibody
NB100-796
Western Blot: ORC3L Antibody [NB100-796] - Staining of HeLa lysate (RIPA buffer, 1.4E5 cells per lane). Antibody at 2 ug/mL. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: ORC3L Antibody [NB100-796] - Staining of paraffin embedded Human Cortex. Antibody at 3.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
SPNS1 Antibody
NBP1-92440
Western Blot: SPNS1 Antibody [NBP1-92440] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: SPNS1 Antibody [NBP1-92440] - Staining of human lung shows strong granular cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: SPNS1 Antibody [NBP1-92440] - Staining of human lung, pancreas, placenta and testis using Anti-SPNS1 antibody NBP1-92440 (A) shows similar protein distribution across tissues to independent antibody NBP1-92441 (B).
Species: Hu
Applications: IHC, IHC-P, WB
LAT Antibody
NBP2-27104
Western Blot: LAT Antibody [NBP2-27104] - analysis of LAT in mouse thymus tissue lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: LAT Antibody [NBP2-27104] - FFPE human small intestine stained with LAT antibody at 10 ug/mL.
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Proprotein
Convertase 7/PCSK7 An ...
NBP2-73621
Flow Cytometry: Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free [NBP2-73621] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-PCSK7 antibody, and then analyzed by flow cytometry.
Immunocytochemistry/Immunofluorescence: Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free [NBP2-73621] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY PCSK7.
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF
LCAT Antibody
NBP1-05950
Western Blot: LCAT Antibody [NBP1-05950] - Analysis of plasma LCAT protein mass. Plasma samples (0.2ul) from four hA-I Tg mice, four hA-I Tg SR-BI -/- mice, a LCAT-/- mouse, and purified mouse LCAT were fractionated on SDS-PAGE, and LCAT was detected by Western blot analysis using rabbit antiserum against mouse LCAT.
Immunocytochemistry/Immunofluorescence: LCAT Antibody [NBP1-05950] - The LCAT antibody was tested at a 1:500 dilution in HeLa cells against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue).
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, WB
Recombinant Human
MBOAT1 GST (N-Term) P ...
H00154141-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

PLA2G7/PAF-AH/Lp-PLA2
DPLG70
(1 Review)
(14 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
ACOT8 Antibody
NBP1-32452
Western Blot: ACOT8 Antibody [NBP1-32452] - Sample(30 ug whole cell lysate)A:MOLT4 B:Raji 10% SDS PAGE, antibody diluted at 1:1000.
Western Blot: ACOT8 Antibody [NBP1-32452] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with ACOT8 antibody diluted by 1:1000.
Western Blot: ACOT8 Antibody [NBP1-32452] - Mouse tissue extracts (50 ug) was separated by 10 % SDS-PAGE, and the membrane was blotted with ACOT8 antibody diluted by 1:1000.
Species: Hu, Mu, Rt
Applications: WB
LPCAT1 Antibody
NBP1-88923
LPCAT1 Antibody
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LPCAT1 Antibody (NBP1-88923)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for LPCAT1 Antibody (NBP1-88923) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-88923:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry LPCAT1 NBP1-88923
Enlarge 		3
reviewed by:
Verified Customer
 IHC Rat 02/12/2013
View

Summary

ApplicationImmunohistochemistry
Sample Testedfrozen (8um sections) DRG Rat tissue
SpeciesRat

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LPCAT1 Antibody (NBP1-88923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LPCAT1 Products

Bioinformatics Tool for LPCAT1 Antibody (NBP1-88923)

Discover related pathways, diseases and genes to LPCAT1 Antibody (NBP1-88923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LPCAT1 Antibody (NBP1-88923)

Discover more about diseases related to LPCAT1 Antibody (NBP1-88923).
 

Pathways for LPCAT1 Antibody (NBP1-88923)

View related products by pathway.

PTMs for LPCAT1 Antibody (NBP1-88923)

Learn more about PTMs related to LPCAT1 Antibody (NBP1-88923).

Blogs on LPCAT1

There are no specific blogs for LPCAT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0
Immunohistochemistry LPCAT1 NBP1-88923
Enlarge
 Verified Customer
02/12/2013
Application: IHC
Species: Rat
read this review

Bioinformatics

Gene Symbol LPCAT1