LPCAT1 Antibody

Western Blot: LPCAT1 Antibody [NBP1-88923] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPCAT1 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Western Blot: LPCAT1 Antibody [NBP1-88923] - Analysis in human cell line BEWO.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

LPCAT1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSV
• Specificity: Specificity of human, mouse LPCAT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPCAT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LPCAT1 Protein (NBP1-88923PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24557352). Rat (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LPCAT1 Antibody

• 1-acylglycerophosphocholine O-acyltransferase
• Acetyl-CoA:lyso-PAF acetyltransferase
• Acetyl-CoA:lyso-platelet-activating factor acetyltransferase
• acyl-CoA:lysophosphatidylcholine acyltransferase 1
• acyltransferase like 2
• Acyltransferase-like 2
• AYTL2
• EC 2.3.1.-
• EC 2.3.1.23,1-alkylglycerophosphocholine O-acetyltransferase
• EC 2.3.1.67
• FLJ12443
• FLJ41609
• LPC acyltransferase 1
• lpcat
• LPCAT-1
• Lyso-PAF acetyltransferase
• lysoPAFAT
• LysoPC acyltransferase 1
• lysophosphatidylcholine acyltransferase 1
• PFAAP3
• Phosphonoformate immuno-associated protein 3
• regulated by phosphonoformate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LPCAT1 Antibody (NBP1-88923)(2)

Publications using NBP1-88923

• Dai X, Han J, Qi Y et al. AAV-Mediated Lysophosphatidylcholine Acyltransferase 1 (Lpcat1) Gene Replacement Therapy Rescues Retinal Degeneration in rd11 Mice. Invest Ophthalmol Vis Sci 2014 Mar 20 [PMID: 24557352] (ICC/IF, Mouse)
• Friedman JS, Chang B, Krauth DS et al. Loss of lysophosphatidylcholine acyltransferase 1 leads to photoreceptor degeneration in rd11 mice. Proc Natl Acad Sci U S A 2010 Aug [PMID: 20713727]

Review for LPCAT1 Antibody (NBP1-88923) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Martin Helley IHC Rat 02/12/2013

Summary

• Application: Immunohistochemistry
• Sample Tested: frozen (8um sections) DRG Rat tissue
• Species: Rat
• Comments: DAPI was then applied for 1 hour to give a nucleus stain followed by one final 10 min wash before FluorSav reagent was used to attach a coverslip

Blocking

• Blocking Details: 10% normal donkey serum was added for 1 hour at RT

Primary Anitbody

• Dilution Ratio: 5% normal donkey serum, 0.2% Triton X, 0.1% azide) were left on for 24 hours in a humidity chamber at room temperature

Secondary Antibody

• Secondary Description: donkey anti rabbit
• Secondary Concentration: 3 hours at RT

Details

• Detection Notes: imaging was performed on a Nikon epifluorescence microscope
• Fixation Details: 4% paraformaldehyde, post-fixed for 4 hours then left in 20% sucrose solution overnight
• Wash Description: 3x 10 min with PBS

Comments

• Comments: DAPI was then applied for 1 hour to give a nucleus stain followed by one final 10 min wash before FluorSav reagent was used to attach a coverslip

Bioinformatics

• Gene Symbol: LPCAT1